(data stored in ACNUC7421 zone)

EMBL: AP009493.PE110

AP009493.PE110       Location/Qualifiers
FT   CDS_pept        109697..112009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_110t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_110t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16939"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB6"
FT                   /protein_id="BAG16939.1"
FT                   /translation="MTESFFMTFAEPGEDLPLPFSGAPSGAENHESGMRREVVTGRGDG
FT                   AVPGPAAYPGLPLGGIDAGGGFDPGARQALALARAVADLRQEALFNFGEMTGVKLTAVL
FT                   EQMLEHSELPDAYLDTVRAVFAPPEGYAAALRQLMEPGAVVVLLREPGAGRSFAAQALL
FT                   ADLRQRTGARVGPLSFGGGSRFPVRRLPLEENVAYLLELPADEEKFEVAEDFGAVLGRI
FT                   QYTLGKRNSRLVVLTAPEQWARICRGAPPGVVPLLGQPDPAKIAVAWLRAEAPELDASK
FT                   WVQDDRIAGLLRNQAPGDVLQVVSLIINATRGRRRSTSTSATTDAFTQQVLDVVAARNN
FT                   WRSSLLQWHSKEGRTSFQRNFLLVAAMFRNAPVAHVYAQTAELSEQLSKREAVALEGQG
FT                   SPGVIEMVDSIDAELAADDTVQFSKPGWDDAVLNYFWVDRPMARTEFLAWMAKAPLART
FT                   TKFLETFTPEDRLLLANRVGAFAVRWAVRHGKANPLEDVVIAWRKDDALWAAAVDLISA
FT                   AALHPTMSRFVHAVLLRWSKNAGADRAALQKISVEVCAGEFGRRHTGKALRRLRHAAET
FT                   VHDDVQTSLYEAVRNLWADASARPTLFSSVVEWCSADPSRAEAGRRSFLALATLLSKED
FT                   RGLPVLLSTGEDQPDFPTADLISGWRTLLDSGSVADDSARAVGLWMDAAVEYPDQRPVV
FT                   FNVLRGAVDTAGRAGGSHPRHRLRDLLYLWQPVPAVDADPERVRLRHELVDLLDHDRSR
FT                   SVALYRPVRMGRGGPTP"
     ttgacggaga gtttcttcat gactttcgct gagcccggag aagacttacc cctgccattt        60
     tctggcgcac cttctggtgc ggagaaccat gaaagcggaa tgcggcggga agttgtgacc       120
     ggccgtggag acggtgcggt tccaggccct gcggcgtatc cggggttgcc gctggggggc       180
     atcgatgccg gcggtggctt cgatcctggt gcgaggcagg cgctggccct ggccagggca       240
     gtcgcggatc tccggcagga ggccctgttc aacttcggtg agatgaccgg ggtgaagctg       300
     acagcggtcc tggagcagat gctggagcac tccgagctgc ctgatgccta tctggacacg       360
     gttcgggccg tgttcgcacc gccagaaggc tacgcggcgg ctttgaggca gctcatggag       420
     ccgggggcgg tcgtcgtgct cctgcgtgag cccggtgcgg gccgttcgtt cgcggcacag       480
     gcactgctcg ctgatctgcg tcagcgcaca ggggcgagag tcgggccgct gagtttcggg       540
     ggcggtagcc ggttcccggt gcgtcggctg ccgctggaag agaacgttgc gtatttgctg       600
     gaactgcccg cggacgagga aaagttcgag gtcgcagagg acttcggtgc ggtgttgggc       660
     aggattcagt acaccctggg caagcggaac tcgcgtctgg tcgttctcac ggcaccggag       720
     cagtgggcga ggatctgtcg gggtgcgcca cccggcgtgg tgcccctgct ggggcagccc       780
     gatcctgcaa agatcgccgt tgcatggctt cgtgccgagg ctcctgagct ggacgcctcc       840
     aagtgggtgc aggacgaccg gatcgcgggc cttctgcgta accaggctcc cggcgatgtc       900
     ctgcaggtag tcagcctgat tatcaacgcc accaggggcc ggcgccggag cacctcgacg       960
     agcgcgacca ccgatgcgtt cactcagcag gtcctggatg tcgtggcggc tcgcaacaac      1020
     tggcgttcca gtctattgca gtggcacagc aaggagggca ggaccagttt ccagcggaac      1080
     ttcctgctgg tagcggccat gttcaggaac gcgccggtag cgcacgtata cgcacagact      1140
     gcggagttgt cggagcagct cagcaagcgg gaggcggtgg ctctggaagg gcagggttcg      1200
     cccggcgtga tcgagatggt cgattcgatc gatgcggagc tggctgcgga cgacacggtc      1260
     cagttctcca agcccggctg ggacgacgcg gtactcaact acttctgggt cgaccggccc      1320
     atggcgcgca cagagtttct cgcctggatg gcgaaggctc cgctcgccag gacgacgaaa      1380
     ttcctggaga cgttcactcc ggaggaccgc cttctgctcg ccaaccgggt cggcgcgttc      1440
     gccgtgcggt gggctgtgcg gcacggaaag gccaatccat tggaagacgt cgttatcgca      1500
     tggcgcaagg acgacgcgct gtgggcggca gcggtcgacc tcatctccgc ggcggcgctg      1560
     cacccgacca tgagccgttt tgtgcatgcc gtgttgttgc gctggtcgaa gaacgccggc      1620
     gcggacaggg cagcgctgca gaagatctcc gtggaggtct gtgccggcga gttcggccgt      1680
     cggcacacgg gcaaagcgct gcggcggctt cgccatgccg ccgagaccgt gcacgatgac      1740
     gtacagacct cgttgtacga ggcggtccgg aacctgtggg cggacgcatc ggcccgtccg      1800
     acgctgttca gctccgtggt ggagtggtgc tcggcggacc cgtcacgggc cgaggccggc      1860
     cgtcgttcct ttctggctct ggcgacactg ctctcaaagg aggaccgcgg cttgccggtg      1920
     ctgttgagca ccggcgagga ccagccggac ttcccgacgg cggatttgat ctccggatgg      1980
     cgcaccttgc tggactcagg ctcggtggcc gacgacagcg cgcgggcggt cggactctgg      2040
     atggacgcag cggtggagta cccggaccag cggccggtcg tgttcaacgt gctgcgcggc      2100
     gcggtggaca ccgcagggcg ggcaggcggc agccatccac gccaccggct acgtgacctt      2160
     ctgtacctgt ggcagcccgt ccccgctgtc gatgccgatc cagaacgggt ccggctgcgt      2220
     cacgaactgg tcgacctcct ggatcacgac cgcagccgat cagtggccct gtaccggccc      2280
     gtgcgcatgg gccgtggtgg accgacgcca tga                                   2313
//

If you have problems or comments...

PBIL Back to PBIL home page