(data stored in ACNUC7421 zone)

EMBL: AP009493.PE111

AP009493.PE111       Location/Qualifiers
FT   CDS_pept        112006..112740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_111t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_111t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16940"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB7"
FT                   /protein_id="BAG16940.1"
FT                   /translation="MSWLRWGLRDQQPELFEDQVTSSQSGLDFTMAFRTEWRAPRSTPV
FT                   PRLPSGEASRTVRVLAEQVAARHTVLRPTAAEQEINRLLARSLPLRTDELEVSWACVSV
FT                   SVAVEVRTYAEQIAQARRELELDALAQRQVQARMRFMHEEILRTPASARIYLMLENSAR
FT                   LGVLPPGLDVDGVVQEIQRWNPQSRWVVVAQLVHTFIDRLSEPDADALLVTLRSLFHDF
FT                   GEPDLAAQVPAPATPPSQAPGS"
     atgagctggc tcagatgggg gcttcgcgac cagcagccgg agctgttcga ggaccaggta        60
     accagctcgc agtcgggtct ggacttcacc atggcgtttc gcaccgagtg gcgtgctcct       120
     cgctcgacgc ccgtgccgcg tcttccgtcc ggggaggcca gccgcaccgt tcgggtactg       180
     gccgaacagg tcgcagcgcg gcacacggtg ctgcggccga ccgcagcgga gcaggaaatc       240
     aaccgtctgc tcgcacgctc gctgccgcta cggacagatg aactcgaggt cagctgggcg       300
     tgcgtcagtg tgtcggtcgc tgtggaggtc cgcacgtacg cggagcagat cgcccaggcc       360
     cgccgggaac tggaactcga tgcgctggcc cagcgccagg tacaggcacg catgaggttc       420
     atgcacgagg aaatcctccg cacccctgcc tcggcccgga tctatctgat gctcgagaac       480
     tctgcccgtc tgggtgtgct gccgcccggg ctggacgtgg acggggtggt gcaggagatc       540
     cagaggtgga acccgcagtc gcggtgggtc gtggtcgcgc agctcgtcca caccttcatc       600
     gaccgcctct ccgaaccgga tgccgacgct ctgctggtca cgctgcgctc gctgttccac       660
     gacttcggag aaccggatct ggctgcccag gtccctgctc cggcgacacc gccctcgcag       720
     gcccccggct cttga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page