(data stored in ACNUC7421 zone)

EMBL: AP009493.PE113

AP009493.PE113       Location/Qualifiers
FT   CDS_pept        113076..116987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_113t"
FT                   /product="putative exodeoxyribonuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_113t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16942"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB9"
FT                   /protein_id="BAG16942.1"
FT                   /translation="MPVGACLLREHGRASAYAASRHPCGVLSVLVSKLSVITDERALLG
FT                   RRAMAYVQHLSVRVPWHDTGWAGTVCADPGANHACVMLGNIAKDRDVRREAAHAGAPWS
FT                   KLGQVLPPCVVERGGFMSSSDHAVRRTHPYGWFLKDLGPARLEVPAFSVHAIPYFWMNR
FT                   SNAEEVVLQERPVSGYNPEAEDRIAAMLDSRLPWVMHGENQQAIMKTFFRDVVPEQSLV
FT                   FFYLKHSPFENQPRRMLVGAACVSGKQPPPPWPGSADSAFPSHMWETTLRHSLRPGGTG
FT                   GILLPVQALAAAAARGMDVASALARAPEVGRNFSYATEHVSSDSTVASLMELRRAAQAA
FT                   TALGDPAIGIPEESLQWLDDQLHRAWKRRGPCPGLPAVLAQLGFRHPTFAAQTIISAAG
FT                   EKADPWPVLENILESETASAELSALATQTRRRIWAGTGPQERQALRVLSRFDLTPEAVS
FT                   GVLSGGTSVPVGHDELLANPYDLVTCTVDDGEPIAFETVDRGCFPDLQLTEHHPLPLTQ
FT                   PFDDANDRRRIDAAMTAVLLRAQEEGHTLLPVEQMAERLGQLTVAVPLATDETILRPLG
FT                   LAPEALLDSDSHDEPEVWSQLRRVDLASGKAAYKLASAALRRDFIRERLNQLRDGKPHC
FT                   VPADLAKTLDTALSGLVAAADSDLEARARVEKAAAFSEIFHRRVTIVNGPAGTGKTTLI
FT                   QALAKRSEVTRRGLLLLAPTGKARVQLEQKVGYQALTLAQFLRHSDRYDDVHGRYLTLP
FT                   DGRRISVGTVVVDEASMLTEDMLAALLDAVEITERLILVGDPRQLPPIGAGRPFVDLER
FT                   RRRPDHSNWPRVAPGWAELTVLHRQQGHTRDDLALAHWYSGDKRSDDAEEVWEKLRTRA
FT                   PMATLKAVHWNGRPAARVLDDVLREEFTVTDELSFTHSYGATTRTDAKGNEYPNYTHAS
FT                   GSCDRWQALSPTRGQTHGTVELNRYLKQTYRRRALADAQLIKSRRRVPQPLGPEQIVVG
FT                   DKVVNTRNQYLRAYRPSTGKTEDRSYVANGELGVVTGQLKSKKMTGAPWQTQVEFSSQP
FT                   DLRFAAQRGLDDDPGLELAWALTVHKSQGSEFGTVVLMLPAHVSGISRELLYTALTRQT
FT                   RKVIICHEGPLEDLRELAQPTASDTARRLTDLTRPPEPVVVHDRQGRRIGCFDANLIHI
FT                   THFGLPVSSKNEVIIADLLHRLARGRFEYEQPLTGRDGKTKFPDFTITTDDPDRPIYWE
FT                   HLGMLDSPRYRETWERKKDWYAAQGILPGDTGGPNGLLLITDDRNGVKEQEWEATFRKA
FT                   FGSTASIRPRSIGRRRGSP"
     atgccagttg gtgcgtgtct gcttcgggaa cacggtcggg cgtcggcgta tgccgcctcc        60
     cgccatccgt gcggtgtgct gtctgtgctg gtgtctaagc tgagcgtcat cacagatgaa       120
     cgcgcgttgt tggggagacg agcgatggcc tatgtacagc acctgtcggt gcgggtccca       180
     tggcatgaca cggggtgggc agggaccgtc tgcgccgacc cgggggccaa tcacgcatgt       240
     gtgatgttgg gcaacatcgc caaggatcgt gacgtgcggc gggaagccgc tcacgccggc       300
     gcgccgtgga gcaagcttgg gcaggtgctg ccgccgtgcg ttgtcgaacg cggcgggttc       360
     atgagcagct ctgatcacgc ggtgcgacga acgcatcctt atggctggtt cctcaaggac       420
     ctggggccgg cgcggcttga ggttccggcg ttctcggtcc acgcaatccc ctacttctgg       480
     atgaaccgga gcaacgctga ggaagtagtc ctccaggaac ggccagtctc cggatacaac       540
     cccgaggccg aggaccggat cgcagcgatg ctcgacagca ggctgccgtg ggtgatgcac       600
     ggtgaaaatc agcaagcgat catgaagacg ttcttccgcg atgtcgtgcc ggagcagtcg       660
     ctggtcttct tctatctcaa gcactcccct ttcgagaacc agccgcggcg catgctggta       720
     ggagccgcat gcgtctcggg aaagcaaccg ccaccgccgt ggcccgggtc ggccgacagc       780
     gccttcccca gccacatgtg ggagaccacg ctgcgacata gtctgcggcc cggcggcacg       840
     ggcggcattc ttcttccggt gcaggcgctg gcggcggccg cggcccgtgg catggacgta       900
     gcgtcggcgc tggcacgggc ccccgaggtc ggccggaact tttcctacgc caccgagcat       960
     gtctcatccg acagtacggt ggcctccctc atggagctgc gccgtgccgc gcaagcagcc      1020
     acggccctgg gcgaccctgc gatcgggatc ccggaggagt ctctgcagtg gttggacgac      1080
     cagctgcacc gggcctggaa gcgccggggc ccgtgccccg gcctcccggc tgtcctggcc      1140
     cagctcggct tccgccaccc caccttcgcc gcgcaaacaa tcatctctgc ggcaggggag      1200
     aaggccgatc cctggcctgt gctggaaaac attctcgaga gcgaaaccgc ttccgccgag      1260
     ctctctgcgc tcgccaccca gacgcgccgc cggatctggg ccgggacggg cccgcaggag      1320
     cggcaggcct tgcgcgtact gagccggttc gatctgacgc ccgaggcggt ttcgggtgtg      1380
     ctgagcggcg gtacaagcgt ccctgtcgga cacgatgagc tgctcgccaa cccctacgat      1440
     ctggtgacct gcaccgtcga cgacggtgag ccgatcgcct tcgagaccgt ggatcgtggg      1500
     tgcttccccg accttcagct caccgaacat catcccctgc cgttgacgca gcccttcgac      1560
     gacgcaaatg accggcgccg tatcgatgcg gcgatgacgg ccgtgctcct tcgtgcccag      1620
     gaagagggac acacgctcct ccccgtcgag cagatggcag agcggctcgg ccagctgacc      1680
     gttgctgttc cgctggccac cgatgagacg atcctcaggc ctctgggcct ggcccccgaa      1740
     gccctgcttg actccgacag ccacgatgaa cccgaggtat ggagccagct gcggcgcgtg      1800
     gacctcgcca gcggcaaggc agcctacaag cttgcttccg ctgccttacg ccgtgatttc      1860
     atccgggagc gtctcaacca gctacgggac ggcaagcctc actgcgtccc agctgacctg      1920
     gcgaaaaccc tggacacggc tctttcagga ctggtcgctg cggcggactc ggacctcgag      1980
     gcccgggccc gcgtggagaa ggccgcagcg ttcagtgaga tcttccaccg gcgtgtgacc      2040
     atcgtcaacg ggccggccgg tacgggcaag acaacgctga ttcaggcctt ggccaagcgt      2100
     tctgaggtca cacgccgagg gctgctcctg ctcgcaccca cgggcaaggc gcgggtacag      2160
     ctggagcaga aggtcggcta ccaggccctc acgctcgccc agttcctgcg tcactccgat      2220
     cgatacgacg acgtgcacgg ccgctacctc accctcccgg acggacgccg tatctctgtg      2280
     ggcactgtgg tcgtcgacga ggcatccatg ctcactgagg acatgctcgc cgcgctcctg      2340
     gacgctgtgg agatcaccga acggctcatc ctggtcggtg acccgcggca gctccccccc      2400
     atcggcgccg ggcggccctt cgtcgatctc gaacgccgcc ggcgtcccga ccacagcaac      2460
     tggcccagag tggcaccggg ctgggccgaa ctgaccgtgc tgcaccggca gcaaggccac      2520
     acgcgggacg acctcgccct cgcgcactgg tacagcggag acaaacgctc cgacgacgcc      2580
     gaggaggtgt gggagaaact gcgcacccgg gcccctatgg caaccctgaa ggccgttcac      2640
     tggaacggtc gccccgccgc acgcgtcctg gacgacgtcc tgcgggaaga gttcaccgtt      2700
     acggacgagc tgtctttcac ccactcctac ggagccacca ccaggacaga tgccaagggc      2760
     aacgagtacc cgaactacac tcacgcgtct ggctcctgcg accgctggca ggcactgtcc      2820
     cccacccgcg gccagacaca tggcaccgtc gaactcaatc ggtacctcaa gcagacctac      2880
     cggcgtaggg cccttgccga cgctcagctc atcaagtccc ggcgacgtgt cccccagccc      2940
     ctgggccccg agcagatcgt cgtgggcgac aaagtcgtca acacccgcaa ccagtacttg      3000
     cgtgcctacc gtccgtccac cgggaaaacc gaggacagga gctacgtcgc caatggcgaa      3060
     ctgggcgtgg tcacaggcca gctgaagtcc aagaagatga ccggcgcccc ctggcagact      3120
     caggtggagt tctcctccca gcccgatctg cgcttcgctg cccagcgagg tctggacgat      3180
     gacccgggcc ttgagctcgc ctgggcgttg accgtacaca agagccaggg cagcgagttc      3240
     ggcaccgtcg tcctcatgct tcccgcccac gtttcgggca tctcccgtga actgctctac      3300
     accgctctga cccgccagac ccggaaggtc atcatctgcc acgaagggcc cttggaagac      3360
     ttgcgtgagc tggcccagcc caccgcatcc gacaccgcgc gccgactgac cgacctcacc      3420
     aggccgcctg agcccgtcgt ggtgcacgac cgccagggac gccgcatcgg ctgcttcgat      3480
     gccaacctga tccacatcac ccacttcggg ctcccggtga gtagcaagaa cgaagtcatc      3540
     atcgccgacc tgctgcaccg cttggcgcgc gggcgattcg agtacgaaca accgctgacc      3600
     ggcagggacg gaaagacgaa gttccccgac ttcaccatca cgaccgacga tcccgataga      3660
     cccatctact gggagcacct cggcatgctc gacagccccc ggtaccggga gacctgggag      3720
     aggaagaagg actggtacgc cgcgcagggc atcctgcccg gcgacacagg cggccccaac      3780
     ggactcctgc tgatcacgga cgaccgcaac ggagtgaagg agcaggagtg ggaagccacg      3840
     ttccggaagg ccttcggctc caccgcgagc atcaggcctc gatccatcgg ccgaaggcgc      3900
     ggatcgccgt ga                                                          3912
//

If you have problems or comments...

PBIL Back to PBIL home page