(data stored in ACNUC7421 zone)

EMBL: AP009493.PE114

AP009493.PE114       Location/Qualifiers
FT   CDS_pept        complement(117256..119205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_114t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_114t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16943"
FT                   /db_xref="InterPro:IPR022205"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC0"
FT                   /protein_id="BAG16943.1"
FT                   /translation="MQLLALALYHRDGRKPPRILRFRPGALNILTGESETGKSEVLTIV
FT                   DYCLGRRAPNLPDDLIDQTVGWYALLVTFADNSRMVLARPRPAGASTQHAYTRTGGAGL
FT                   DIPRSDELVSNSNVAALRSELSARLGIEDFHFQPPTGAARNAFDVSIAQAALLCFQSQN
FT                   EIADQTALFHRQTESGMVQALKDTLPYFLGAAGPEQALRRHRLGESQRAQRAAQRKLDD
FT                   ALRHQQAMDANGLALVRLAEAEGLLTEVPAAPDTTQVLDLLHQALAAAPETAAPLELRD
FT                   RRQELNDERRALREQLQEFDEALAAVDRWQQQGRAFTGELHLQLDRLKTLDLLGPERRH
FT                   DTSVCPMCTQPLEHPDPSAHDITELTGHLASELAKAQTLQPVREEHRRALQTGRTDVTE
FT                   RLRLNGAQLKELLASDERLRNLQEQNLRVAHIQGRVSEALTRTGTDSDIARLRQNLVLA
FT                   QDQAATLEQLVDEDDVAAETERRLADIAVGMTAWAKRLNLGGAADATEVAISLKLLNVV
FT                   LRRPSGRLPLTRIGSAKNHIGYHLVAHLALHTYLRRNNRPVPGFLMLDQPTQAFFPEKP
FT                   RDASTIQDADWATVTAYFQLLNDVVQLNQGAFQIIVCDHANLPEGWFQEAVIGNWRPDA
FT                   DGRRTALIPLDWLG"
     atgcaactgc tcgccctggc cctctaccac cgagacggca ggaagccccc aaggatcctg        60
     cggtttcgcc ccggggcgct caacatcctc accggcgagt cagagaccgg caagtccgag       120
     gtcctcacca tcgtcgacta ctgcctcggg cgccgcgcac ccaacctgcc tgacgacctg       180
     atcgaccaga ccgtcggctg gtacgccctc ctggtcacgt tcgccgacaa ctcacgcatg       240
     gtcctggccc ggcccaggcc ggcaggagcc tccacccagc acgcgtacac ccgcaccggc       300
     ggcgccggcc tggacatccc acgatccgac gaactcgtca gcaactccaa cgtcgcagcg       360
     ctgcgcagcg agctcagcgc ccgcctcggc atcgaggact tccacttcca gccacccacc       420
     ggcgctgccc gcaacgcctt cgatgtctcc atcgcccagg cggctctgct ctgcttccag       480
     agccagaacg agatcgccga ccagacagcc ctgtttcacc gacaaaccga atccggcatg       540
     gtccaggcgc tcaaggacac cctgccgtac tttctcggcg ccgccggccc cgagcaggca       600
     ctgcgccgcc accggctcgg cgaatcccag cgcgcccagc gcgcggcaca acgcaagctc       660
     gacgacgcac tgcgccatca gcaggccatg gatgccaacg gcctcgccct cgtacgcctg       720
     gcggaagccg aaggcctcct gactgaggtg cccgcagcac ccgacaccac ccaggtcctc       780
     gacctactcc accaggccct ggccgcagcc ccggaaaccg ccgcaccact cgaactgcgt       840
     gacaggcgcc aggaactcaa cgacgaacgc cgcgccctgc gtgaacaact gcaggaattc       900
     gacgaggccc tggccgcggt cgaccgttgg cagcagcagg gacgagcttt caccggcgaa       960
     ctccacctcc agctcgaccg cctcaaaacc ctcgacctcc tcggccccga gcgccggcac      1020
     gacaccagcg tgtgccccat gtgcacccag cccctggaac acccggaccc cagcgcacac      1080
     gacatcaccg aactgaccgg gcacctcgca agcgaactcg ccaaggcaca gacactccag      1140
     cccgtccgcg aggaacaccg acgagccctt cagaccggac gcaccgacgt caccgagcgc      1200
     ctcaggctca acggcgccca gctcaaagaa ctcctggcaa gcgacgagcg cctgcgcaac      1260
     ctgcaagaac agaacctacg agtcgcccac atccagggcc gagtctccga agcactaacc      1320
     cgcacaggca cagacagcga cattgcccgg ctgcgccaga acctcgtcct cgcccaggac      1380
     caagcagcca cactggaaca gctcgtcgat gaagacgacg tcgcggccga gacggagcgc      1440
     cggctcgccg acatcgccgt cggtatgacg gcctgggcca agcgactcaa cctcggagga      1500
     gcagccgacg ccaccgaggt agccatcagt ctcaagctcc tcaacgtcgt cctcaggcga      1560
     ccctccggac ggctgcccct cacccgcatc ggcagtgcca agaaccacat cggctatcac      1620
     ttggtcgccc acctcgcgct gcacacctac ctgcgacgca acaaccgacc cgtcccaggc      1680
     ttcctgatgc tcgaccagcc cacccaggca ttcttcccgg aaaagccccg tgacgcatcc      1740
     accatccagg acgccgactg ggccaccgtc accgcctact tccaactcct caacgacgtg      1800
     gtacagctca accagggagc tttccagatc atcgtctgcg accacgcgaa cctgcccgaa      1860
     ggctggttcc aggaagccgt gatcggcaac tggcgtcccg atgccgacgg caggcgcacc      1920
     gctctgattc ccctggactg gctcggctaa                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page