(data stored in ACNUC7421 zone)

EMBL: AP009493.PE115

AP009493.PE115       Location/Qualifiers
FT   CDS_pept        complement(119237..119722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_115t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_115t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16944"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC1"
FT                   /protein_id="BAG16944.1"
FT                   /translation="MTTDSHRNVSEVQALFNPAFGAYLLASAVNTATKKAERPLPWPSA
FT                   FLILPLVLPADTRDSLPGKSTVTLTAWAHEHPRLQAAFAERAATLTNYTRTSLRTAMRH
FT                   QAIDVTPGGLVCPRTPKPASAAPGEEVADCARAAALVGRWLAVTDPTRAFTTLGVRP"
     gtgacgaccg actcccaccg caacgtgtcg gaggtacagg cgctgttcaa ccccgccttc        60
     ggcgcctacc tcctggccag tgccgtcaac accgccacga agaaggcgga gcggccactg       120
     ccctggccca gcgcgttcct gatccttcct ctcgtgctgc ccgcagacac ccgcgactct       180
     ctccccggca agtccaccgt cacgctcaca gcctgggcac acgaacaccc gcgcctgcag       240
     gccgcattcg ccgaacgcgc cgcaacactg accaactaca cccgcaccag cctgcgtacc       300
     gccatgcgcc accaggccat agacgtcacc cccggcggac tcgtatgccc ccgcaccccc       360
     aagcctgctt ccgccgcccc cggcgaagag gtcgccgact gtgcccgcgc agccgcactg       420
     gtcggccgct ggctcgccgt gaccgacccc acccgcgcct tcaccaccct cggcgtccgg       480
     ccctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page