(data stored in ACNUC7421 zone)

EMBL: AP009493.PE116

AP009493.PE116       Location/Qualifiers
FT   CDS_pept        complement(119719..121101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_116t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_116t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16945"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC2"
FT                   /protein_id="BAG16945.1"
FT                   /translation="MLRCGPGERNSASHQTEQPRAAFLVRPVAGVGLAPLRPARSVVGN
FT                   VARARSHSAAGQMTGYLYQGELALLELARRSWQDPTVEVRMELLDDIEFLDPDKTPREL
FT                   LQAKHREAAGPLSETGKDFWRSVASWIDALKKLSDPADAAMPILRLVSTQTAPPGTFFQ
FT                   YLSDGPDRDETKALERMEETADDADGPVTTAEDRELFMQLAPARRQQLVRAITVNDAAP
FT                   LMSDLDSSLAKELGITPSDHAQAALDEIKGWWYGMAVKLLERKNPQHMRASVSAQELMC
FT                   RRDEVTGRYIGKNLPITETLRHLTQAEIADYNDRLVVTQMRWIGLPDDEVAMHLRDYHY
FT                   ARAQRSEWLRTFKITPERLDEYEGELHYEWETAFRRRTRRIRDDMSEEQRQDIGQEILD
FT                   ATMDRVADTQLRPGSVTAPWIGTGSAHGLSDQADTAEPDRQLGWHPNYQDLCQSPDESQ
FT                   EQ"
     gtgctacgtt gtggcccagg ggagcggaac agcgcatcgc accagaccga gcagcctaga        60
     gctgcattcc tggtacggcc ggtcgcaggg gtgggacttg cgccgctcag gccagcacga       120
     tcagtagtgg ggaacgtggc gcgagcaagg tcgcattcgg cggcagggca gatgaccgga       180
     tatctctacc agggcgagct ggccctgctc gagctcgccc gccgcagttg gcaggacccc       240
     accgtcgagg tccgcatgga acttctcgac gacatcgagt tcctcgaccc ggacaagacc       300
     ccacgcgaac tgctgcaggc caaacaccgt gaagcggccg gcccgctgag cgagaccggc       360
     aaggacttct ggcgttccgt cgcgtcctgg atcgatgccc tgaagaaact ctccgacccc       420
     gcagatgccg ccatgcccat cctgcgcctg gtctcgaccc agaccgcacc gccaggcacg       480
     ttcttccagt acctcagcga cggcccggac cgggacgaga ccaaggcgct ggagcgtatg       540
     gaggagaccg ccgacgacgc ggacgggccg gtcaccaccg ccgaagaccg tgagctgttc       600
     atgcagctcg ccccggcccg gcgccagcag cttgtccgcg ccatcaccgt caatgacgcg       660
     gcccccctga tgtcagacct ggactctagt ctcgccaagg aactggggat cacgccgagc       720
     gaccacgcgc aggcagccct cgacgagatc aaggggtggt ggtacggcat ggcggtcaaa       780
     ctgctggaac gcaagaaccc ccagcacatg cgagcctccg tcagcgccca ggaactcatg       840
     tgccgacggg acgaagtcac cggccgctac atcggcaaga acctgccgat caccgagaca       900
     ctgcgccacc tcacccaggc agagatcgcc gactacaacg accgcctggt cgtcacccag       960
     atgcggtgga tcggcctgcc cgacgacgaa gtggcgatgc acctgcgtga ctaccactac      1020
     gcacgggcac agcgctccga atggctgcgc accttcaaga tcaccccgga acggctcgac      1080
     gaatacgaag gtgaacttca ctacgagtgg gagacagcct tccgccgccg tacgcgccgc      1140
     atccgagacg acatgagtga agagcaacgc caggacatcg gtcaggaaat cctggacgcc      1200
     accatggacc gggttgctga cacccaactg cgacccggca gcgtcaccgc cccctggatc      1260
     ggcaccggaa gcgcccacgg cctgtccgac caggccgaca ccgcggagcc cgaccggcaa      1320
     ctcggctggc accccaacta ccaagacctc tgtcagagcc ccgacgaatc gcaggaacag      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page