(data stored in ACNUC7421 zone)

EMBL: AP009493.PE117

AP009493.PE117       Location/Qualifiers
FT   CDS_pept        complement(121306..121740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_117t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_117t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16946"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC3"
FT                   /protein_id="BAG16946.1"
FT                   /translation="MKARTGSAVRVDPWAVCDWVVWKLEVDDPEQRISESYHEAGMGLL
FT                   LAADSRETMVGFASRLGCVYEGCKDDGSYGSDNDSCYAWWIRVPQAAHTQRTARGWPLV
FT                   VEECRQQLDRMFADGHHWHGWVDEGRTRALSTGEMMPPLL"
     gtgaaggcac ggacgggtag cgctgtcagg gtcgatccct gggctgtgtg cgactgggtg        60
     gtctggaagc ttgaggtcga tgatcccgag cagaggatca gcgagtccta tcacgaggcc       120
     ggtatggggc ttctcctggc ggcggacagc cgagaaacga tggtgggctt tgcctcccgg       180
     ctcgggtgcg tttatgaggg ctgtaaggac gacggaagct atggaagcga caacgattcc       240
     tgctacgcct ggtggatccg ggtgccgcag gctgcacaca cccagcgcac cgcccgcggg       300
     tggccccttg tcgtggagga gtgccggcaa caactcgacc gcatgttcgc tgacggccat       360
     cactggcacg gatgggtcga cgagggccgc acccgggctc tgtcgacggg ggagatgatg       420
     ccaccgctgc tgtaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page