(data stored in ACNUC7421 zone)

EMBL: AP009493.PE119

AP009493.PE119       Location/Qualifiers
FT   CDS_pept        123437..123715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_119t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_119t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16948"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC5"
FT                   /protein_id="BAG16948.1"
FT                   /translation="MAVLAYRPGAMQWIVDLPEAARVCGPAFADSTPLCGADANYAPPG
FT                   ISSTAGQQSIARAEFCQLAGYPLLDYDDSYKIGLVGIHLTRQGLLIG"
     atggcggttc ttgcataccg gcccggtgcg atgcagtgga tcgtggatct tccggaggcc        60
     gcccgggtgt gcggcccggc attcgccgac agcactcccc tctgcggggc ggacgcgaac       120
     tacgccccgc cgggcatctc atcgactgcg ggacaacaat ccatcgctcg cgccgagttc       180
     tgtcagcttg ccggataccc cctgctcgac tacgacgaca gttacaagat cgggctggtc       240
     ggcatccatc tgacgcgaca gggcctgttg atcggctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page