(data stored in ACNUC7421 zone)

EMBL: AP009493.PE120

AP009493.PE120       Location/Qualifiers
FT   CDS_pept        complement(123895..125793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_120t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_120t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16949"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC6"
FT                   /protein_id="BAG16949.1"
FT                   /translation="MAPTPDLVREIAAIRRMLADSEPAPVRSSYLADPSQGRPVHQGST
FT                   APALVPEWHQHPSGLLVPASSAQSPAPIDLMAVYLTAEEIFGFVPPSDYTERQLERIPL
FT                   EDVLRFCAWALTALAMPDASARDVEKTFVNTLMQGPLRDRVLNLLRDDRRRLLVPQAVM
FT                   LLARTAVHVSPDTVPQGAPKGDLTVALLCNSQSMGHHSESGPTVIADQPGPLGREIIAN
FT                   QHFNHTWSVSGVLARYARRWLELPMEHLSEPGAIDLSQAYEDCTGVRLDDLAAVAGYLW
FT                   ARTTQGHFVLEHAEYSALTLPAERLHRVLSLISNDLPGMREAVRQERPEHRTEWSFDPF
FT                   QRWPVIRLPQRRLLVLDPRHLVSRAFGWLPILDIRFPPPHHPRPSGHKTLATRAEQTLR
FT                   RISEVYVSEVLHRITEDASTVRRVYDDAQLKAAYTVKGQRIADAAVDYPGTWIVIEVTT
FT                   TQLRREAATAVPDESQIKDIDKLIEEVDQINATIDALRQDETALTGISPTHPRRFLPLL
FT                   VLPEGFPVNPVTLTVIRERARSRGLLQAPDTDPLEIADIEELEMIEGIQEDGGPSLLEI
FT                   LQSKNAGTLRNTGLREHIFYGLNLSPSKPARHAELFATALQPLFEALPRPEPEPPA"
     atggccccta cacctgacct ggtcagggag atagcagcga taagaaggat gctcgctgac        60
     agcgagccgg cccccgtgcg ctcaagctac cttgccgacc cctcacaagg ccgccctgtc       120
     catcaaggtt caacagctcc agctctcgtt ccggaatggc accaacaccc cagcggtttg       180
     ctggttcccg catcgtcggc gcagagccct gcccccatcg acctgatggc cgtctacctc       240
     accgcagaag agatcttcgg gttcgtaccg cccagcgact acacagagcg acagctggaa       300
     cggatccccc tggaggacgt gctccggttc tgcgcctggg cactcaccgc tctcgcgatg       360
     cctgatgcct cagcgcgaga cgtagagaag acattcgtga acacgctgat gcaggggcca       420
     ttgcgtgatc gtgtgctgaa cctcctcaga gacgaccgcc gcagacttct tgtcccccaa       480
     gccgtcatgc ttctggcccg cacggcagtg cacgtatcgc cagacaccgt gccgcagggc       540
     gccccaaagg gtgacttgac cgtcgccctg ttgtgcaaca gccagagcat ggggcaccac       600
     tccgaatcag gcccgaccgt catcgcggac cagcccggcc ctctgggccg ggaaatcatt       660
     gccaaccagc acttcaacca cacctggtct gtctccggcg tcctggcccg ctatgcacgc       720
     cggtggctcg agctgcccat ggaacacctc tcagagcccg gagccatcga cctcagccag       780
     gcctacgagg actgcaccgg cgttcggctc gacgacctgg ccgccgtcgc cggctacctg       840
     tgggcccgta ccacacaagg acacttcgtc ctggaacatg ccgaatactc ggcactgacc       900
     ctgcccgccg agcgactcca ccgcgtgctc tcgctgatca gcaacgatct gcctggtatg       960
     agagaagcag tccggcagga acggccggaa caccgcaccg aatggtcctt cgaccccttc      1020
     cagcgctggc ccgtcatccg cctgccccaa cgccgactgc tggtcctgga cccccgtcac      1080
     ctcgtgagcc gtgcctttgg gtggctgccg atcttggaca tccggttccc accgccccac      1140
     caccccaggc cgtccggcca caagaccctc gccacccgcg ccgaacagac tctgcgccgc      1200
     atcagcgagg tgtacgtcag cgaagttctc caccggatca ccgaggacgc atccaccgtc      1260
     cggcgcgtct atgacgacgc gcagctcaaa gccgcctaca cggtcaaagg ccagcgcatc      1320
     gccgacgccg cggtcgacta tccgggaacc tggatcgtca tcgaggtcac cacgacccag      1380
     ctacgccgtg aagcggccac tgccgtgccc gacgaatcac agatcaagga catcgacaag      1440
     ctcatcgagg aagtcgacca gatcaacgcc accatcgatg ccctgcgcca ggacgagaca      1500
     gccctcaccg gcatatcacc cacacacccg cgacgtttcc tgcccttgct cgtcctgccc      1560
     gaaggctttc ccgtcaaccc tgtgactctg accgtgatcc gcgagcgcgc acgatcccga      1620
     ggccttctcc aagcgccgga caccgacccc ctcgaaatcg ctgacatcga agaactggag      1680
     atgatcgaag gcatacagga agacggtgga cccagcctcc tggagatcct gcagagcaag      1740
     aacgccggca cactgcgcaa cactggcctg cgcgagcaca tcttctacgg cctgaacctc      1800
     agtccgtcca agcccgcccg gcacgccgaa ctcttcgcta ccgccctgca acccctcttc      1860
     gaagccctgc ccagaccgga gcctgagccg cctgcgtga                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page