(data stored in ACNUC7421 zone)

EMBL: AP009493.PE121

AP009493.PE121       Location/Qualifiers
FT   CDS_pept        complement(126320..127660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_121t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_121t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16950"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC7"
FT                   /protein_id="BAG16950.1"
FT                   /translation="MLRVSKPVSHQWDGKEEADGRGSVSAASYDLGMAYESARDLPSYL
FT                   ELERQLKVVRFLGRSNRKLADAIRLQLREFGDTVDAFYDLFGGKHWIFHDRLPLEPVRA
FT                   IVANAGEDVDGAERKLIELYHDAESLPFMILPLRKLPAMRRRLTLVERARQDYFAGRYY
FT                   ATVQVLLSVMDGFVNEFESVRRGLHARAPEELQAWDSVVGHHRGLQHAHKTFTKGRTAT
FT                   LEEPVYELYRNGIVHGSILNYDNLTVATKAWNRLFAVADWAAARLKQQEHQSKEPVTLS
FT                   SVGRQLKELTSTALRQAEINRVNEKWNPGRHLPGSETFNSHPAHTHTRELLNCWMRRNY
FT                   GSLSDLLTYDLHTRHGKAVRSEVRRVYDPFVLSAFEILSIHHDMAAACTVTATLDHGSS
FT                   ATTEVELRWVREDAQSYPTPEPWPGNWRLVTWDPRCYLGRIAPSSSR"
     gtgttgcgtg tgagtaaacc ggtgtcgcac cagtgggatg ggaaggaaga agcggacgga        60
     cgaggcagtg tcagtgccgc ttcttacgat ctgggcatgg cctacgaatc tgctcgtgat       120
     cttccttcct atctggagct cgaacggcaa ctgaaggtgg tgaggttcct cgggagaagc       180
     aatcggaagc tggccgatgc gatccggctt cagctgcgag agttcggcga cacggtcgac       240
     gccttctatg acctgttcgg gggaaagcac tggatcttcc acgaccggct gcccctggaa       300
     ccggtgcggg ccattgtcgc caacgcagga gaggatgtgg acggggcgga acggaagctc       360
     atcgagctct accacgacgc cgagagtctg ccgttcatga tccttccgct gcggaagctg       420
     ccggccatgc gccgcaggct caccctggtg gaacgggccc ggcaggacta cttcgcaggc       480
     cgctactacg ccactgtcca ggtgctgctg agcgtcatgg acggcttcgt caacgagttc       540
     gagagcgtgc gccgtgggct gcacgcacgc gctcccgagg aactgcaagc ctgggacagc       600
     gtcgtcggcc accatcgcgg cctccagcac gcccacaaga cgttcaccaa agggcgcacg       660
     gccacactgg aagaacccgt ctacgagctc taccgcaacg gcatcgtgca cggcagcatt       720
     ctcaactacg acaacctcac agtcgcgacc aaagcctgga accggctgtt cgccgtcgct       780
     gactgggccg ccgcgcgcct gaagcaacag gaacaccagt ccaaagaacc agtcacactc       840
     tccagcgtgg gacgccagct caaagaactc accagcacag ccctgcgaca agccgagatc       900
     aaccgcgtca acgagaagtg gaaccccggc aggcatctcc ccggaagcga gaccttcaac       960
     agccaccccg cccacactca tacccgcgaa ctgctgaact gctggatgcg ccgcaactac      1020
     ggctccctga gcgacctgct tacctacgac ctgcacaccc ggcacggcaa ggcggtacgc      1080
     agcgaggtcc ggcgggtcta cgaccccttc gtgctctccg cattcgagat cctctccatc      1140
     catcacgaca tggcagcagc ctgcacggtc accgcaacgc ttgatcatgg aagcagcgcc      1200
     acgactgagg ttgagctgcg atgggtcaga gaggacgccc agtcctatcc cacgcctgaa      1260
     ccctggccag ggaactggcg gctggtgacc tgggatcctc gctgctactt gggccggatc      1320
     gccccctcct cgtcccggta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page