(data stored in ACNUC7421 zone)

EMBL: AP009493.PE122

AP009493.PE122       Location/Qualifiers
FT   CDS_pept        complement(127755..128036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_122t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_122t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16951"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC8"
FT                   /protein_id="BAG16951.1"
FT                   /translation="MAIQITAVRLTAGGTTHEHITHLWWTNQASGNSGNNTRAQLVDWI
FT                   DNQSGEAYTDAAGHRTKVVVVTPTRGEKYLRTHADGVWTNNLLALPRR"
     atggccatcc agatcaccgc ggtacgcctg acagccggcg gtaccaccca tgaacacatc        60
     acccacctgt ggtggaccaa ccaggcctcc ggcaacagcg gcaacaacac ccgggctcag       120
     ctcgtcgact ggatcgacaa ccagtccggc gaggcctaca ccgacgcagc cggacaccgc       180
     acgaaggtcg tcgtcgtgac gcccactcgg ggcgagaagt acctgcggac ccacgccgac       240
     ggcgtgtgga ccaacaacct cctcgccctc cccaggcgct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page