(data stored in ACNUC7421 zone)

EMBL: AP009493.PE123

AP009493.PE123       Location/Qualifiers
FT   CDS_pept        complement(128183..129208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_123t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_123t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16952"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC9"
FT                   /protein_id="BAG16952.1"
FT                   /translation="MVNYVRAGAARTQAAAMITELEAARPGAAELLAQDALAKLRTWPE
FT                   LTVKDVPENETAQGCSVAGAYDYGPPPRLSVATSASHARRDFTALHELGHHLQKNSFDL
FT                   MEPFSREPDGGVLLEDAACDAFAAQILLPAHLVDQHLDAKGPTASAITLLWKTSNASRM
FT                   AVCVRAAQHLPAPGHVLLLDPDGHLAFAASNGLPPLPRGSFQGDIPVIDRALTGPGRAQ
FT                   GRTQVRYRDGILGRELHTDTAPMDGYTVAVLVTDSAPWRAFTPPTADTGPRSRDYICAN
FT                   CDENYRSFEPACPRCHVPHCPECGSCACPPRTPGRSCPGCFLKHPPAMFAPDSDRCLDC
FT                   S"
     gtggtcaact acgtacgcgc cggcgccgcc cgcacccagg ccgccgccat gatcacggaa        60
     ctcgaagcag cccgccccgg tgccgccgaa ctcctggcgc aagacgccct cgcaaaactg       120
     cggacctggc ccgagctcac cgtcaaagac gttcccgaaa acgagacggc acagggctgc       180
     agcgtcgccg gagcatacga ctacggcccc ccgccccgcc tgtccgtcgc cacctccgcc       240
     agccacgcac ggcgggactt caccgccctg cacgaactcg gtcaccacct gcagaagaac       300
     agcttcgacc tcatggagcc cttcagccgg gaacccgacg gcggtgtcct cctcgaagac       360
     gccgcctgcg acgcgttcgc cgcccagatc ctgctccctg cacacctcgt cgaccagcac       420
     ctggacgcca aaggacccac cgcctcagct atcaccctcc tgtggaagac gagcaacgcc       480
     tcccgcatgg ccgtctgcgt acgagcagcc cagcacctcc ccgcccccgg tcacgtcctc       540
     ctcctcgacc ccgacggaca cctcgccttc gccgcctcca acggcctgcc gcccctgccg       600
     cgcggcagct tccaaggcga catccccgtc atcgaccgcg ccctgaccgg cccaggccgc       660
     gcacaaggac gaacccaggt ccgctaccgc gacggcatcc tcggacgcga actgcacacc       720
     gacaccgccc ccatggacgg ctacaccgtc gctgtcctcg tcaccgactc cgccccctgg       780
     cgcgccttca ccccacccac cgccgacacc ggcccccggt cgcgcgacta catctgcgcg       840
     aactgcgacg agaactaccg ctccttcgaa cccgcctgcc cgcgctgcca cgtccctcac       900
     tgtcccgaat gcggcagctg cgcctgcccg ccccgcaccc ccggccgctc ctgccccggc       960
     tgcttcctca agcacccgcc cgcgatgttc gccccggaca gcgaccgctg cctcgactgc      1020
     tcctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page