(data stored in ACNUC7421 zone)

EMBL: AP009493.PE124

AP009493.PE124       Location/Qualifiers
FT   CDS_pept        complement(129233..130174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_124t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_124t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16953"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND0"
FT                   /protein_id="BAG16953.1"
FT                   /translation="MDHSRGDGGDSMSSVHTTAYQRLVAAAAGLKVPDAVHQAATAPPQ
FT                   DPRPGQIWRAVWDDTIQLLLITTAGDQDTARAVPASFERYADADTLLLPAPATTLEQPL
FT                   ALWWGLETTLPWCVLDRPVSELTSRPDPLTSRMLADTVTGARWGSSTLVPAAAGEYRAA
FT                   LTDHLEVLASAQWAPQGSGGLSELLRDHAITVQQLAAELKLPPPLALDMWRGQQPLNAE
FT                   QADTLAALLGQPAARFLDTNPALPPAVVHELNRPLRRSQVKKLAAQYDETEHAARLRAA
FT                   YGVYTLAARDDNRTQPNWNARTDRYFELLLDE"
     atggaccaca gccgaggaga cgggggagac agcatgagct ctgtccacac cactgcctac        60
     cagaggctcg tagccgccgc agcgggcctg aaagtgcccg atgccgtcca ccaggcggcc       120
     accgcaccac ctcaggaccc ccgccccggc cagatctggc gcgcggtatg ggacgacacc       180
     atccagctgc tgctgatcac cacggccgga gaccaggaca ccgcccgcgc cgtaccggcc       240
     tccttcgaac gctacgcgga cgccgacacc ctgctcctgc ccgccccggc cacgaccctg       300
     gagcagccct tggcgctctg gtggggcctg gaaaccactc ttccgtggtg cgtactggac       360
     cggccggtca gcgagctgac aagccgcccc gaccccctta cctcccgcat gctcgccgac       420
     accgtcaccg gcgcccgatg gggcagcagt actctcgtgc ccgcagcagc cggcgaatac       480
     cgcgccgccc tcaccgacca cctcgaggtc ctcgcctcgg cacaatgggc cccgcaaggg       540
     tcaggcggcc tctccgaact ccttcgcgac cacgccatca ccgtccagca gctcgcggcc       600
     gaactgaaac tgccaccgcc cctggccctg gacatgtgga gggggcaaca gcccctcaac       660
     gccgagcagg ccgatacgct cgccgcactc ctcggccagc ccgccgcccg cttcctcgac       720
     accaacccag ctctgccgcc cgccgtcgta cacgaactca accggcctct gcgccgaagc       780
     caggtcaaga aactcgccgc ccagtacgac gagaccgaac atgccgcccg tctgcgtgcc       840
     gcctacggcg tctacacgct cgcggcacgc gacgacaacc gcacccagcc gaactggaac       900
     gcacgcactg accgctactt cgagctcctc ctggacgaat ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page