(data stored in ACNUC7421 zone)

EMBL: AP009493.PE125

AP009493.PE125       Location/Qualifiers
FT   CDS_pept        complement(130222..131181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_125t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_125t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16954"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND1"
FT                   /protein_id="BAG16954.1"
FT                   /translation="MGHVTQSAYEELQTGGLGPATFELLRRLVHQVRRGTGFPPPEGHT
FT                   AWSDDAAYDVISAMLSREGAGQRFVTACFTQAADEASLERLFLTSIKNFLIDEAKKTPR
FT                   GKLRRRIARLMGEDAAYRKLKGSPPRWALADHVEGAVWQGDLDDLIAQAAQVKGVGITR
FT                   WNHAGPTPRQTVHALKTVLLSVLRYAQGAVREEDLAKVLEARFDLLEPARFTALYADEG
FT                   TVAETVEQHAAAAAPDPTGVEGVAEDIWQRLTPNDRLLLPCIDEDAHHAAQLLEIRQGH
FT                   AAAVLSNLKTMLRNALSADIDPHAVMAALLRRCSETAS"
     gtggggcacg tgacacagag cgcgtacgag gagctgcaga ccggcgggtt ggggccggcc        60
     acgttcgaac tactgcggag gctggttcac caggtgcgtc gtggcaccgg ctttccgccc       120
     cccgagggcc acacggcatg gagcgatgac gcggcttacg acgtgatcag cgcgatgctg       180
     tcccgggaag gagcgggaca acggttcgtg accgcctgct tcacccaggc cgccgacgaa       240
     gcctccctgg agcgactgtt tctcacgtcg atcaagaact tcctcattga cgaggcgaag       300
     aagacaccgc gaggcaagct ccggcgccgt atcgcccggc tgatgggcga agacgcggcc       360
     taccgcaagc tcaagggttc cccgccgcgc tgggcactgg ccgaccatgt cgaaggtgcc       420
     gtatggcagg gagacctcga cgatctcatc gcccaggccg cacaggtgaa aggcgtcggc       480
     atcacccgct ggaaccatgc cggccccaca ccccggcaga cagtccacgc cctgaagacc       540
     gtcctactgt ccgtgctccg gtacgcacag ggagcggtgc gggaggaaga cctcgccaag       600
     gtcctcgaag cccggtttga tcttctggaa ccggcccgtt tcaccgccct gtacgccgat       660
     gaggggaccg tcgccgaaac ggtcgaacag catgcggcgg ccgcagcccc ggacccgacc       720
     ggggttgagg gggtggccga ggacatctgg cagcgcctca cgcccaacga ccgcctgctg       780
     cttccctgca tcgacgagga cgcccaccac gcggcgcagc tgcttgagat ccggcaaggc       840
     cacgcagccg cggtcctgtc caacctcaag accatgctcc gtaatgctct gtccgcggac       900
     atcgaccccc atgcggtcat ggccgccctg ctgcggcgct gcagtgagac cgcctcgtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page