(data stored in ACNUC7421 zone)

EMBL: AP009493.PE126

AP009493.PE126       Location/Qualifiers
FT   CDS_pept        complement(131394..132551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_126t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_126t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16955"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND2"
FT                   /protein_id="BAG16955.1"
FT                   /translation="MVRRSLTDAEARWVLEVVQSGRMTQTEAAAALGGTLSRINQLVNG
FT                   RTYKHLHGTAGVRVTDGGERYGITETPERRKFREASFWDRVDHSAGVNACWPFKGVKGN
FT                   KYGHTAAGQAMTGSASAHVVAFTLASGLQQALPGSTLLRHLCDFKPCCNPAHLLPGTKS
FT                   ENNRDTWVARREGRTGAKKVAEPVTPPQGGWSISTGDLVELDREARVSEFWARIDRRGG
FT                   DDACWPWTAKTRNHFGYGQLRWEGVQAALTHRIAYALSQGVTYKELGPAVIRHTCPEST
FT                   YRNNCNNPRHLRAGSQAENIADKAFHGTNARGERHPMGRRFPDALIREMRIRFWSVPPE
FT                   RRPTITALAKEAGTSVTVMSRWLRGEQRNDAGGPIAAMPGDFPRG"
     atggtcagac gatcactgac ggacgctgaa gcgcggtggg tgttggaggt ggtgcagtcc        60
     ggccggatga ctcaaaccga ggccgcggcg gcgctagggg gcacgttgtc tcggatcaat       120
     cagttggtca acgggagaac ctataagcac ctccacggca cagccggagt acgggtaact       180
     gatggtggcg agcggtacgg catcaccgag acgcctgagc gccgtaagtt tcgggaagcg       240
     agtttctggg accgtgtcga ccactcagct ggagtgaacg cttgctggcc cttcaagggc       300
     gtcaagggca acaaatacgg acacaccgct gctggccaag ccatgaccgg ctcggcgagc       360
     gcacatgtcg tggccttcac ccttgccagc gggctacagc aagccctgcc gggcagcacg       420
     ctgctcagac acctgtgcga cttcaagccc tgttgtaatc ccgcccacct gctccccggg       480
     acaaagagcg aaaacaatcg ggacacttgg gtcgcccgca gagaaggccg cacaggagcg       540
     aagaaggtgg cggagccggt cacgcctcca cagggagggt ggagcatctc gacaggagat       600
     ctcgtcgaac tggaccgcga ggcccgtgta tcggagttct gggctcggat cgatcgcagg       660
     ggcggagacg acgcttgctg gccctggacg gcgaagacgc gcaaccactt cggatacgga       720
     cagctcaggt gggagggcgt ccaggcagcc ttgacacatc gcatcgcgta tgcgctctcc       780
     caaggggtga cgtacaagga gcttgggccc gcggtcatcc gccacacgtg ccctgagagt       840
     acttacagga acaactgcaa taaccctcgg cacctcagag ccggttcgca ggccgagaac       900
     attgccgaca aggccttcca cgggaccaat gccagaggcg agcgccaccc aatggggcgc       960
     aggttcccag acgccctgat ccgcgagatg cgcatccgct tctggagcgt tcccccagag      1020
     cggcggccga cgatcactgc actggcgaag gaagccggaa catcggtcac cgtcatgagc      1080
     cgatggcttc gaggcgagca gcgaaacgat gctggcgggc cgatcgccgc catgcctggc      1140
     gacttcccgc gaggttga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page