(data stored in ACNUC7421 zone)

EMBL: AP009493.PE129

AP009493.PE129       Location/Qualifiers
FT   CDS_pept        complement(135450..136307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_129"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16958"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND5"
FT                   /protein_id="BAG16958.1"
FT                   /translation="MQDGDVKGHTPHDQVHHLDAETHTDPAAELRGLERSLTASTDPDA
FT                   AAHTRLREADASLVAFLRRRNFEGPHYRTFTAELMDYGWRTLSTWTASGHIFERTARMG
FT                   RPVPPAMMPDSWTYEDRTQVVTDTVIKGSSLFREHGLVRGKWTPDGGASLTTYFVGATI
FT                   LAFRPVYIRWHKNHHVGQSELNHRTADTDDILYAQQDIPDQRATDPAQAAVTHDDITRL
FT                   RTLLPDEQLREALGWMALGYTQAEAADRVGLTPKALERRLARARNRISASGLHTVQLEE
FT                   GGAR"
     gtgcaggatg gagacgtcaa ggggcacacc ccccacgacc aagtccacca cctcgacgcg        60
     gagacccaca cagaccccgc agccgaactg cgcggcctcg aacgctccct gaccgcaagc       120
     acggacccgg acgccgcagc gcacacccgg ctccgggaag ccgacgccag cctcgtcgcg       180
     ttcctccgcc ggcggaactt cgaaggaccg cactaccgga ccttcaccgc cgagctgatg       240
     gactacggat ggcgcacgct gagcacctgg accgccagcg gccacatttt cgaacgcacc       300
     gcccgcatgg gccgcccggt accaccggcg atgatgcccg actcctggac ctacgaggac       360
     cgcacccaag tcgtcaccga caccgtcatc aagggcagca gcctcttccg cgaacacggc       420
     ctggtccgcg ggaagtggac ccccgacggc ggcgccagcc tcaccaccta cttcgtcggc       480
     gcgaccatcc tcgccttccg ccccgtctat atccgctggc acaagaacca ccacgtcgga       540
     cagtctgaac tcaaccaccg cacagccgac accgacgaca tcctctacgc ccagcaggac       600
     atccccgacc agcgcgccac cgaccccgcc caggccgccg tcacccacga cgacatcacc       660
     cggctgcgca cgctgctgcc cgacgaacaa ctgcgcgagg cgctcggctg gatggccctg       720
     ggctacaccc aggccgaggc cgccgaccgc gtgggcctga cgcccaaggc gctcgagagg       780
     cgcctggccc gcgcccggaa cagaatttct gccagcggac tgcacaccgt ccagctggag       840
     gaggggggag cacgatga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page