(data stored in ACNUC7421 zone)

EMBL: AP009493.PE13

AP009493.PE13        Location/Qualifiers
FT   CDS_pept        21132..21512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_13t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_13t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16842"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL1"
FT                   /protein_id="BAG16842.1"
FT                   /translation="MATVRAALDATLGIPHQAREVRLHRFSNADGPYWAADPEFHPDGT
FT                   CTALKPGAQRIASTDNATVQNVAWRNPDGSRALIAQTAAAPPSPSESTGAASPSPTPSR
FT                   HAPPPPSPGPARPAAHHRRSGR"
     gtggcgaccg tacgggccgc tcttgacgcc accctcggca tcccgcacca ggcccgggag        60
     gtgcggctgc accgcttctc caacgccgac ggcccgtact gggccgccga ccccgaattc       120
     cacccggacg gcacctgcac cgccctcaag cccggagccc agcggatcgc ctcaaccgac       180
     aacgcgaccg tgcagaacgt ggcctggcgc aacccggacg gctccagggc actaatcgcg       240
     caaacagcgg cggctccgcc cagtccctcc gagtcgactg gggcggccag tccttcacct       300
     acaccctccc ggcacgcacc accgccacct tcacctgggc cggcacgccc cgcggcccat       360
     caccgcagat cgggccgcta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page