(data stored in ACNUC7421 zone)

EMBL: AP009493.PE130

AP009493.PE130       Location/Qualifiers
FT   CDS_pept        136504..136860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16959"
FT                   /db_xref="GOA:B1VND6"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND6"
FT                   /protein_id="BAG16959.1"
FT                   /translation="MYTPPGPGPVGGTGGDAGRGAGQEPSVRDAAPGCSPGQVAQAAPG
FT                   RQDPASRDLPQGPQGEGPLLGLRSAIILMLGILVATAAGVLTYSAQQDPATAALAAGGA
FT                   FAGGVLFFQKIIAG"
     atgtacacac cccccggccc gggccccgtg ggcggcacgg gcggcgacgc cgggcgcggc        60
     gccgggcagg agccttctgt ccgcgacgcg gcaccgggct gttctccggg ccaggtggcg       120
     caggccgccc ctggccggca ggatccggcg agccgcgatc tgccgcaggg cccccagggt       180
     gaggggccgc tgctgggcct gcgcagcgcg atcatcctga tgctgggcat cctcgtcgcc       240
     acggctgccg gtgtcctgac ctacagcgcc cagcaggacc cggccaccgc ggccctcgcg       300
     gcaggcggtg ctttcgccgg cggggtcctc ttcttccaga agatcatcgc cggatag          357
//

If you have problems or comments...

PBIL Back to PBIL home page