(data stored in ACNUC7421 zone)

EMBL: AP009493.PE131

AP009493.PE131       Location/Qualifiers
FT   CDS_pept        137370..139826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_131"
FT                   /product="putative molecular chaperone with protein kinase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_131"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16960"
FT                   /db_xref="GOA:B1VND7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND7"
FT                   /protein_id="BAG16960.1"
FT                   /translation="MEPLRAGDPESVGGFVLRGRLGAGGMGEVFLGRSPGGRAVAVKVV
FT                   HPHLARQEEFRQRFAREVAAARAVSGAFTAPVMAAGPEDDRPWIATVYVPGPDLATAVG
FT                   VAGPLPEGAVWRLAAGLVEALQAIHVVGVVHRDLKPSNVLVAADGPRVIDFGIARTLED
FT                   TPLTMTGLVVGTAGFMAPEQAEGGKVGSACDVFALGAVIAFAATGAGPFGEGPQLAVLR
FT                   RVVGGRPRLDGLTGPLRELVEACLAKDPRDRPALATLLERIGAHWEPADEFRGGSPWPE
FT                   AVTTLIQRHATPPTAPYTEAAGATAPPDGGPNAARRARRAVGIDFGTTNSAVAVMEGGE
FT                   VLLIPNAQGRHTTPSLVALTAEGDALVGTDAERQALANPGFTAGAAMLWLGTDWRVARG
FT                   GVRLTAEDVAGLVLARLREDAEAYLGEPVTDAVLAVPAGFRRDQRAALVAAGERAGLNV
FT                   LRLVNVPTAVATSYGPNRDDLTVLVFDLGGGTLDVSLIELGDGVVEIRATAGDSRLGGN
FT                   DWDQRIVEHLTDHVRRRHGVDLTGDVAAIQRLREAAETARIELSAARTTTVRLPYLATG
FT                   PDSPVHLEEELTREELERLTQDLLERCRTPVENVLADAGCTLADIDQVVLTGGAALMPA
FT                   VGDLVRRLTGGQGSYQRLSPEAVVHGAVLQAGILTGEVKDVLLLDVAPYSIGVETHDGT
FT                   MKKLLQRNTTIPTRRSDVFTTHTDDQPMVLFHIVEGERKDAARNWPLAVLELALPPAPR
FT                   GVPMIEVTVDCTASDDLHIKVRDLGTGNETSATVGQATKERAAALLRSSRWARLRDLVP
FT                   VTHPAC"
     gtggagccgc tgagggccgg agatccggag tcggtgggtg ggttcgtact gcggggccgg        60
     ctgggtgctg gcgggatggg cgaggtgttt ctgggccggt cgccgggtgg gcgggcggta       120
     gcggtgaagg tagtgcatcc gcatctggcg cggcaggaag agttccggca gcggttcgca       180
     cgggaggtgg cggcggcgcg ggcggtgagc ggggcgttca cggctccggt catggcggcg       240
     ggtcctgagg acgatcggcc gtggatcgcg accgtctacg ttccgggtcc tgatctggcg       300
     acagcggtcg gtgtggcggg gccgttgccg gaaggcgcgg tgtggcggct ggcggcgggg       360
     ctggtggagg ccttgcaggc cattcacgtg gtgggggtag tgcatcggga tctgaagccg       420
     tcgaacgtgc tggtggccgc cgacgggccg cgggtgatcg atttcggaat cgcgcggacg       480
     ctggaggaca ccccactgac gatgaccggc ctggtggtgg ggacggcggg cttcatggcg       540
     cccgagcagg ccgagggcgg caaggtcggt tcggcctgtg acgtgttcgc gctgggggcg       600
     gtgatcgcct tcgccgccac gggggcgggc cctttcgggg agggcccgca gctggcggtt       660
     ctccgccggg tggtcggcgg gcggccccgg ctggacgggc tcacgggccc gttgcgtgag       720
     ctggtcgagg cgtgtctggc gaaggatccc cgtgaccggc ctgcgctcgc gacgttgctg       780
     gagcggatcg gcgcgcattg ggagccggcg gacgagttcc gcggcggctc tccctggccg       840
     gaggccgtca ccactctcat ccagcggcac gccacgcccc cgaccgcccc ttacaccgaa       900
     gccgccgggg ccacggcgcc gccggacggc ggaccgaacg cggcgcggcg ggcgcgtcgg       960
     gccgtcggca tcgacttcgg gacgacgaac tcggcggtcg ccgtcatgga gggcggcgag      1020
     gtcttgttga tccccaacgc ccagggcagg cataccactc ccagcctggt ggccctcacc      1080
     gccgaggggg acgcgctggt cggcacggac gccgagcggc aggcccttgc caaccccggc      1140
     ttcaccgcgg gcgccgccat gctgtggctg ggcaccgact ggcgtgtcgc gcggggcggg      1200
     gtacggctga ccgccgagga cgtcgccggg ctggtcctcg cccgcctgcg cgaggacgcc      1260
     gaggcctacc tcggcgagcc ggtcaccgac gcggtgctgg cggtgcccgc tggtttccgt      1320
     cgcgaccagc gtgccgcgct ggtcgcggcc ggtgaacggg ccgggctcaa cgttctgcgg      1380
     ctggtcaacg tgcctacggc cgtggcgacg tcctacgggc cgaaccggga cgacctcact      1440
     gtcctggtct tcgatctcgg cgggggcacc ctcgacgtct ccctcatcga actcggtgac      1500
     ggcgtcgtgg agatcagggc caccgcgggc gacagccgcc tcggcggcaa cgactgggac      1560
     cagcggatcg tcgagcacct gaccgaccat gtgcggcggc ggcacggcgt ggatctcacc      1620
     ggcgatgtcg ccgcgatcca gcggctgcgc gaggcggccg agacggcaag gatcgaactg      1680
     tcggcggcgc gtaccacgac cgtccggctg ccttatctcg ccaccggtcc ggacagcccc      1740
     gtccaccttg aagaggaact gacccgcgag gagttggaga ggctcaccca ggacctgctg      1800
     gaacgctgcc gaaccccggt cgaaaacgtc ctcgccgacg ccgggtgcac gctcgccgat      1860
     atcgatcagg tcgtcctgac gggcggtgcc gccctgatgc ctgcggtggg cgacctggtc      1920
     cgccggctca cgggcggcca ggggtcctac cagcgtctga gcccggaggc cgttgtccat      1980
     ggcgcggtgc tccaggcagg catcctgacc ggggaggtga aggacgtgct gctcctggac      2040
     gtcgccccct actcgatcgg cgtcgaaacg cacgacggga ccatgaagaa gctgctccag      2100
     cggaacacga ccatccccac gaggcgctcc gacgtcttca ccacgcacac ggacgaccag      2160
     cccatggtgt tattccacat cgtggagggc gagcgaaagg acgccgcgcg gaactggccc      2220
     ctcgccgtcc tcgaactcgc cctgcctccc gctcctcgcg gtgtgcccat gatcgaggtg      2280
     acggtcgact gcaccgccag cgacgatctt catatcaagg tcagggatct gggcacgggc      2340
     aacgagacgt ccgccacggt cggccaggcg acgaaggaac gagcggcggc gctcctgcgc      2400
     tcctcccgct gggcccgcct gcgtgatctc gtccctgtga ctcacccggc ctgttga         2457
//

If you have problems or comments...

PBIL Back to PBIL home page