(data stored in ACNUC7421 zone)

EMBL: AP009493.PE132

AP009493.PE132       Location/Qualifiers
FT   CDS_pept        complement(140037..140435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_132"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16961"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND8"
FT                   /protein_id="BAG16961.1"
FT                   /translation="MTWGTNPGVINRELSKRLAAGRDRRLTQLADAATRWGGHVPEDPG
FT                   ITELADLLETAAADVPAPPGDPGHTARPGAPGHPARTLLAGAVENLRAAARLGGHLPAV
FT                   TLWHLQRAIDQEHTAHQQTVPAQRQGRT"
     gtgacctggg ggacaaatcc cggggtgatc aaccgggagc tctccaaacg cctggcagcc        60
     ggccgcgacc gccgtctcac ccagctcgcc gacgcagcca cccgctgggg cggacacgta       120
     cccgaggacc ccggcatcac cgaactcgcc gacctcctcg aaaccgccgc agcggacgtt       180
     cccgccccgc ccggcgaccc cggtcacacc gcccggcccg gcgcccccgg gcaccccgcc       240
     aggactctcc tggccggtgc ggtcgaaaac ctccgggccg ccgcccggct cggaggacac       300
     ctccccgcgg tcaccctctg gcacctccaa cgcgccatag accaggaaca caccgcccac       360
     cagcagaccg tccccgcaca acgccaagga cgcacctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page