(data stored in ACNUC7421 zone)

EMBL: AP009493.PE133

AP009493.PE133       Location/Qualifiers
FT   CDS_pept        complement(140500..141678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_133"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16962"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND9"
FT                   /protein_id="BAG16962.1"
FT                   /translation="MSVRLILTIADAVRRASQKHHHGQEHDLPDDIGQMAQSWWSADEL
FT                   GKHLPGSLLDHLTNTPDWPVTARQLVSLSRAGVDLTQFLPNLATMAAGVERAVARNTAR
FT                   TKTEGTDRWADLLRTTLPDGLVRNAILASPTWPDIAATMGRLHDQGIDVTRILTDAHTA
FT                   GLRIDQTIATAITPTTAPAPAAPAAPAAPAPAPAAPTAAPAPAAAVPLAPEVSADARNL
FT                   WGPLTEGLDIPHDLDLSDRARALEQLGITPAAHRTLVSQVNEALPQRDAALLVSSRQWP
FT                   ALAHRMTQQNGPLAAHLARIAPDTASWRTGPPSGITTRLLLAAHHALTTPLDQPLPTGP
FT                   RVSTTAARSRSTTVPDTATPKQPAPAGPAPTEPAAPAHRRTTAPAPRQGRGR"
     atgtccgtcc ggctgatcct cacgatcgcg gacgcggtcc gccgcgcctc ccagaaacac        60
     caccacggcc aggaacacga cctgcccgac gacatcggac agatggcgca gtcctggtgg       120
     tccgccgacg aactcggcaa gcacctgccc ggctccctcc tcgaccacct caccaacacc       180
     cccgactggc ccgtgaccgc ccgccaactc gtctccctca gccgcgccgg cgtcgacctc       240
     acccagttcc tcccgaacct cgccaccatg gccgcaggcg tcgagcgcgc cgtcgcccgc       300
     aacaccgccc gcacgaagac cgagggcacc gaccggtggg ccgatctcct gcgcaccacc       360
     ctccccgacg gcctggtccg gaacgcgatc ctcgcctccc ctacctggcc cgacatcgcc       420
     gccaccatgg gccgcctcca cgaccagggc atcgacgtca cccgcatcct caccgacgcc       480
     cacacagcag gcctccgcat cgaccagacc atcgccaccg ccatcacccc caccaccgcg       540
     cccgcgcccg cagccccggc cgcgcccgct gcgcccgccc cggccccggc cgctcccacc       600
     gcggccccgg ccccggccgc ggccgtgccg ctcgctccgg aggtgagcgc cgacgcgagg       660
     aacctctggg gcccgctcac cgaaggcctc gacatccccc acgacctcga cctcagcgac       720
     cgcgcccgcg ccctggaaca gctcggcatc acccccgccg cccaccgcac cctggtgagc       780
     caggtcaacg aagccctgcc ccagcgggac gccgcgctcc tggtgagctc ccgtcagtgg       840
     cccgccctcg cccaccgcat gacccagcag aacgggcccc tggccgcgca tctcgcccgg       900
     atcgcacccg acaccgcctc ctggcgcacc ggcccgccct ccggcatcac cacccgcctc       960
     ctcctggccg cccaccacgc cctcaccaca ccactcgacc aacccctgcc caccggcccc      1020
     cgcgtctcca ccaccgcagc ccgctcccgc tccaccaccg tcccggatac cgccacaccg      1080
     aagcagcccg cgcccgccgg acccgccccc accgaacccg ccgcccccgc acaccgccga      1140
     accaccgccc ccgcaccccg ccaaggacgc ggacgatga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page