(data stored in ACNUC7421 zone)

EMBL: AP009493.PE134

AP009493.PE134       Location/Qualifiers
FT   CDS_pept        141857..142792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_134"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16963"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE0"
FT                   /protein_id="BAG16963.1"
FT                   /translation="MRSGGGSGRYCGNGRGCGGATGRGGCHPYGARRCCGAGGGAGQVG
FT                   GFAQEGGGLGGGCCLSAVLVERPAAQRGGGAGQVGGFAQEGGGLGPLSGRPPVDRAGRC
FT                   PVFVKVASVPLIMANRLGRWALRLGVRVVGTVMAMREGSRLCVMCGTGLLGGTAYLVDG
FT                   ARRQGRRTPTRFLICGSCYDRGCPDPETGLTRAVSTRQTQSIEWRELAGRGPALPPQAC
FT                   VAGCGLVVVRGAEKTMRGVTCSRACRTSITRKRHGGIGSSRPCGACGTPVTAGRADSEY
FT                   CNAACRQKAYRSRRARRLLSNPVPDQNLHA"
     gtgcggtccg gtggggggtc gggtcggtac tgcggtaacg ggcgggggtg tggcggggcc        60
     acgggccggg gcgggtgtca cccgtacggt gcgcggcggt gttgtggtgc gggcgggggc       120
     gccggtcagg tcggcggctt cgcgcaggag ggcggcggcc tgggcggcgg ctgttgcctg       180
     agtgctgttc tcgttgagcg gccggccgct caacggggcg ggggcgccgg tcaggtcggc       240
     ggcttcgcgc aggagggcgg cggcctgggc ccgttgagcg gccggccgcc cgtcgaccgt       300
     gctggaaggt gtccggtctt cgtgaaggtg gcgagcgtcc cgctgatcat ggcgaatcgg       360
     ctgggccggt gggcgttacg actgggcgtg cgggtcgttg ggactgttat ggctatgcgt       420
     gaaggttctc ggctctgcgt gatgtgcggg accggtctgc tcggcgggac ggcatatctg       480
     gtcgacggcg cccggcggca gggtcgtcgg acgcctactc gcttcctgat ctgcgggtcc       540
     tgctacgacc gagggtgtcc ggatccggaa acgggtctga cccgggcggt ctccacccgg       600
     cagacacaga gcatcgagtg gcgggagctg gccggccgag gcccggcgct cccgccgcag       660
     gcctgtgtcg ccgggtgcgg cctggtcgtg gtgcgcgggg cggagaagac gatgcggggg       720
     gtgacatgct cacgggcgtg ccggacatcc atcacacgca aacgtcacgg aggcatcgga       780
     tcgagccgcc cctgcggcgc ctgcggcacg cccgttacgg ctgggcgtgc ggattctgag       840
     tactgcaacg cggcctgccg gcagaaggca taccgcagcc ggcgcgcccg ccgactgctg       900
     tcgaaccccg tcccggatca gaaccttcac gcgtag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page