(data stored in ACNUC7421 zone)

EMBL: AP009493.PE137

AP009493.PE137       Location/Qualifiers
FT   CDS_pept        complement(144434..144931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_137"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16966"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE3"
FT                   /protein_id="BAG16966.1"
FT                   /translation="MAVLNVHERLVAAGADAVGELLDTLSAGPEDRLWPSAHWPAMRLD
FT                   RGLSPGSAGGHGPIRYAVNAYEPGARVRFDFTGPPGFHGFHEFAVVPVDAHRTLLRHTL
FT                   SMRTTGAARLAWPLLYRPLHDALVEDALDRAEPTARPARWSPYVRLLRTALARRGWSPS
FT                   DK"
     atggccgtcc tgaatgtgca cgaacgtctg gtcgcggcgg gcgccgacgc ggtgggtgag        60
     ctgctcgaca ccctctccgc cgggcccgag gaccggctct ggccctcggc ccactggccc       120
     gccatgcggc tcgaccgcgg gctgtcgccc ggatcggccg gtgggcacgg tccgatccga       180
     tatgccgtca acgcctacga gcccggtgcg cgggtgcggt tcgacttcac cgggccgccc       240
     ggattccacg gcttccacga gttcgccgtg gtcccggtcg acgcgcaccg cacccttctg       300
     cggcacacgc tgtcgatgcg gaccacggga gcggcccgcc tggcctggcc cctcctctac       360
     cgcccgctcc acgatgcctt ggtggaggac gccctggacc gcgccgagcc gaccgcccgg       420
     cccgcccgct ggagcccgta cgtccgactg ctgcgcacgg ccctagcccg gcggggctgg       480
     agcccgtctg acaaatga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page