(data stored in ACNUC7421 zone)

EMBL: AP009493.PE139

AP009493.PE139       Location/Qualifiers
FT   CDS_pept        146885..147574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_139"
FT                   /product="putative gamma-butyrolactone-binding protein
FT                   homologue"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_139"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16968"
FT                   /db_xref="GOA:B1VNE5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE5"
FT                   /protein_id="BAG16968.1"
FT                   /translation="MRRLVQQRSMHKRQELVAAAARVFAEKGYYRTTVEDITTLAGVGR
FT                   GAFYHYFNKGKSDVATAVVTEGFTMDAAVPMLPRIQSVVDASIALATLTPVVPVVKAAA
FT                   RLATEQDHPDFYGHLIRLYIPQVTQLIEQAAELGELQQGVDPALTAEAWVMLYSGTDQH
FT                   ARLDYRRLPQKIAQANTVIVRGIVTAETALKLDMSVQRGDLLVRQSRWAEEYIQGLDAA
FT                   ASAGSPA"
     gtgcggcgac tggtccagca gcggtccatg cacaagcggc aggagctggt ggcggccgcc        60
     gcacgggtct tcgccgagaa gggctactac cggaccacgg tcgaggacat cacgacgctg       120
     gccggggtcg gccgcggcgc gttctaccac tacttcaaca agggcaaatc cgacgtcgcc       180
     acggcagtgg tgacggaagg cttcacgatg gacgcggcgg taccgatgct gccgcgcatc       240
     cagagcgtgg tggacgcctc catcgccctc gcgacgctca cccccgtggt tccggtcgtc       300
     aaggccgccg cacggctcgc caccgagcag gaccatcccg acttctacgg ccacctgatc       360
     cggctgtaca tcccccaggt cactcaactg atcgagcagg cagcggagtt gggggagctt       420
     cagcagggcg tggatccggc cctcacagcg gaggcgtggg tcatgctcta ctcgggaacc       480
     gatcagcacg cccgcctgga ctatcgtcgg ctgccgcaga agatcgcgca ggcgaacacg       540
     gtcatcgtgc gcggcatcgt caccgccgaa acagccctga agctggacat gtcggtgcag       600
     cgcggcgacc tcctggtgcg gcagtcccgc tgggccgagg agtacatcca gggcctcgac       660
     gccgcggctt ctgccggcag cccggcctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page