(data stored in ACNUC7421 zone)

EMBL: AP009493.PE14

AP009493.PE14        Location/Qualifiers
FT   CDS_pept        21539..21733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_14t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_14t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16843"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL2"
FT                   /protein_id="BAG16843.1"
FT                   /translation="MADGSSADGTAAQLHTCNSTVAQRRSYSATTHDVVNTAADKCLDV
FT                   TGNNSADGIWSCTGAANQK"
     gtggccgacg gatcgagcgc cgacggcacc gccgcccaac tccacacctg caacagcacc        60
     gtcgcccagc gacggtccta cagcgcgacc acgcacgacg tggtcaacac cgctgcggac       120
     aagtgtctgg acgtcacggg caacaattcg gccgacggga tctggtcctg cacaggagca       180
     gccaatcaga agtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page