(data stored in ACNUC7421 zone)

EMBL: AP009493.PE140

AP009493.PE140       Location/Qualifiers
FT   CDS_pept        148019..148822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16969"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE6"
FT                   /protein_id="BAG16969.1"
FT                   /translation="MRSRRAEWRGRAVPGAGREYQRLMERYRRRRTRKEIGLGPLPSGR
FT                   GRRGSDRIRQVDVDTALQGGAGTYQKICTGRLRPSPDLYMRLAQLLGFSREDTVLGHLE
FT                   LFRTEPVLPPVPPSPLLGRLIGGQGEIACAITPDGRRVAANSAFAALFPGGGPPANLWR
FT                   WALFSPDAERVLLDWEQAWAPRLLTEIKVMCRRAQRDGAALRLLSEVEGDARLRAVEET
FT                   GSGLGGAPLPLRHPALGDGTVHLLTARTAGASILTFIFEPGDQEL"
     gtgcgcagcc gccgggccga gtggaggggg agagcggtgc cgggagcggg gcgcgagtac        60
     cagcggctga tggagcgcta ccggcgtcgg cggacccgga aggagatcgg gctcggcccc       120
     cttccctccg gtcggggccg ccgcgggtcc gaccgcatcc ggcaggtcga cgtcgacacc       180
     gccctccagg ggggcgcggg cacctatcag aagatctgca cgggccggct gcggccctca       240
     ccggacctct acatgcgtct ggcgcagctg ctgggattca gccgggagga cacggtcctc       300
     ggccacctgg agcttttccg gaccgagccg gttctgcccc ctgtgccgcc ctcgccgttg       360
     ttggggcgtc tgatcggcgg ccagggcgag atcgcgtgcg cgatcacgcc cgacgggcgc       420
     cgggtggccg ccaactccgc cttcgcggcc ctgttccccg gaggcgggcc gccggccaac       480
     ctgtggcgct gggcgctgtt cagccctgat gcggaaaggg ttctgctgga ctgggaacag       540
     gcatgggccc cgcgcctgct gaccgagatc aaggtgatgt gccggcgcgc gcagcgggac       600
     ggcgcggccc tgcgtctcct gtcggaggtc gagggggacg cacggctgcg ggcggtcgag       660
     gagaccggca gcgggctcgg cggcgctccc ctgccgctgc gccacccggc actcggcgac       720
     ggaaccgtgc acctgctcac cgcgcgaacg gccggcgcga gcatcctgac cttcattttc       780
     gaacctggcg accaggagct gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page