(data stored in ACNUC7421 zone)

EMBL: AP009493.PE141

AP009493.PE141       Location/Qualifiers
FT   CDS_pept        148819..149457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_141"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16970"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE7"
FT                   /protein_id="BAG16970.1"
FT                   /translation="MMHILVPEDPVFMTRFLDVEEPLLHSLYYLHRGHMPRDQAKTVAR
FT                   AYEAWGDIQAAMPKFLSWHTPTAFELAVPRRESEGHRLHSPDGRQLISLYAVDVGVESI
FT                   SGLAACLTLLEEAEKDLGGALAGALEEIREPRERDLVDNFRRVLQALRIPAPPALLASL
FT                   RDAAPAGPVQEVTLDCGQHAEYTAFGDRFCRAVSSGDLFMYTMHRSLYP"
     gtgatgcaca tcctcgtgcc ggaggacccg gtgttcatga cgcggttcct ggatgtggag        60
     gaacccctcc tccactccct gtactacctc caccgcggtc acatgccgcg ggaccaggcg       120
     aagacggtcg cccgggccta cgaggcctgg ggcgacatcc aggcggcgat gcccaagttc       180
     ctgagctggc acacgccgac cgcgttcgag ctcgccgtgc cacgccggga gtcggagggc       240
     caccgcctcc acagccccga cggcagacag ctgatcagcc tgtacgcggt ggacgtgggc       300
     gtggagagca tcagcggcct ggcggcgtgc ctcacgctgc tcgaagaggc cgagaaggac       360
     ctgggcggag cgctggccgg cgcactcgag gagatcaggg agccgcggga gcgggatctg       420
     gtcgacaact tccgccgggt cctgcaggcg ttacggatac cggcgccccc cgccctgctc       480
     gcgtcgctgc gggacgcggc cccggccgga ccggtgcagg aggtcaccct ggactgcggg       540
     cagcacgccg agtacacggc cttcggcgat cggttctgcc gggccgtgag ctcgggcgac       600
     ctgttcatgt acacgatgca ccggtccctg tacccctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page