(data stored in ACNUC7421 zone)

EMBL: AP009493.PE147

AP009493.PE147       Location/Qualifiers
FT   CDS_pept        complement(154038..155606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_147"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_147"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16976"
FT                   /db_xref="GOA:B1VNF3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNF3"
FT                   /protein_id="BAG16976.1"
FT                   /translation="MTPAPHAAAPGGPDRSADPGTGEPAVRIRGLTRNFGPVRALRDVS
FT                   FDVPAGEITALLGENGAGKSTLLKILAGLQPPSEGGVTVFGEEVTSFEPAAMLSRHGVA
FT                   IVPQELSLLLDRTVAENVLSGVEPGNRWFPSRRRMLERTTELLAELDLHLDPNASVRTL
FT                   DLATQQLIVVARSIARGCRVLILDEPTAMLTPAEADRLFTLMGRLKATGTTMLYVSHRM
FT                   PEVFRLADHIQVLRDGGHVASWRSEDTTPDQAVAAMVGRELGRLTRRADAAAVPTAEPA
FT                   LKIRGLSGRRHRDVSFDLRPGEILGIAGLPDSGRVELLHNLFGGDSGTGGTVELLGEPY
FT                   ERRNPIASVERRLAFVPGERRAQGLLTTMSVGENVGALTAKAFSRLGLIRRRAFDAAAT
FT                   EQARLLGVKTATMTQPITSLSGGNQQKAVLGRWLAIDPGVLILDEPTRGVDIGAKAEIY
FT                   AQLTALADKGLAILCSSSDLPELLTLTDRIAVMSEGRLVAVVDSADATEESVMTLATGA
FT                   VPAAA"
     atgacccccg caccccacgc cgccgccccc ggaggcccgg accgctccgc ggacccgggc        60
     accggcgagc cggccgtccg gatccgcggc ctcacccgca acttcgggcc ggtccgcgcc       120
     ctgcgcgacg tctccttcga cgtccccgcc ggtgaaatca cggcactcct cggggagaac       180
     ggcgccggca agtcgacgct gctcaagatc ctggccggtc tccagccgcc cagcgaaggc       240
     ggtgtcaccg tcttcggcga agaggtcacc tccttcgaac cggccgccat gctcagccgg       300
     cacggcgtgg cgatcgtccc ccaggaactg tcgctgctgc tcgaccgcac cgtcgccgag       360
     aacgtgctca gcggagtcga accgggcaac cgctggttcc cctcccggcg ccgcatgctg       420
     gagcgcacca ccgaactcct cgccgaactc gacctccacc tggacccgaa cgcctccgtc       480
     cgcaccctgg acctggccac ccagcagctc atcgtggtcg cccgatccat cgcccgaggc       540
     tgccgagtcc tgatcctgga cgaacccacg gcgatgctga cacccgccga ggccgaccgc       600
     ctgttcaccc tcatgggccg gctcaaggcc accgggacga ccatgctcta cgtctcccac       660
     cggatgccgg aggtcttccg cctcgccgac cacatccagg tgctgcgcga cggcggccac       720
     gtcgcctcat ggcgcagcga ggacaccacc cccgaccagg ccgtcgccgc catggtcggc       780
     cgcgaactgg gccggctcac ccgccgggcc gacgccgccg ccgtgcccac ggccgaaccc       840
     gccctcaaga tccgcgggct gagcggcaga cgccaccggg atgtctcctt cgacctgcgc       900
     cccggggaga tcctcggcat cgccggactg cctgactccg gacgcgtcga actgctccac       960
     aacctcttcg gcggggactc cggcaccggc ggcaccgtcg aactgctcgg cgaaccctac      1020
     gaacggcgca acccgatcgc cagcgtcgag cgccgtctgg cgttcgtacc cggcgagcgc      1080
     cgcgcccagg gcctgctgac cacgatgagc gtcggcgaga acgtcggtgc cctcaccgcc      1140
     aaggcgttca gccggctcgg cctgatccgc cgccgcgcct tcgacgcggc agccaccgag      1200
     caggcccggc tcctgggggt caagacggcc accatgaccc agccgatcac cagcctgtcc      1260
     ggtggaaacc agcagaaggc cgtcctcggc cgctggctcg ccatcgaccc gggcgtgctc      1320
     attctcgacg aacccacccg aggtgtggac atcggcgcca aggcagagat ctacgcccag      1380
     ctcaccgctc tcgccgacaa gggcctggcg atcctctgct cctcctccga cctgcccgaa      1440
     ctgctcaccc tgaccgaccg catcgcggtc atgagcgagg gccgcctcgt ggccgtcgtc      1500
     gactccgccg acgccaccga ggaatccgtg atgactctcg ccaccggagc cgtgccggcc      1560
     gcagcctga                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page