(data stored in ACNUC7421 zone)

EMBL: AP009493.PE148

AP009493.PE148       Location/Qualifiers
FT   CDS_pept        complement(155606..156637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_148"
FT                   /product="putative ABC transporter solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_148"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16977"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNF4"
FT                   /protein_id="BAG16977.1"
FT                   /translation="MAPRTLLRSLIAATAAAAALSLTACGAITSADGSSGSSGDGSFKL
FT                   APYIQQRIDDDKPMRIKLSYHDPSLAFATPISAGMKKAGKETGADVALIGPTGGDAAKQ
FT                   VSEIQTLIQQKAVDGLAVSSASSDALKPVISQAYKAGIPIISFNTDNPDSDQMGFVGQD
FT                   LKGSGKAQAEQLRKDLKGDLNGKSVVVFSVDTGAGWSHDRFSGFKEGLDGSGLKVVGPV
FT                   NVGNEPSSAYNTVESTMSGQSNVVAVAGLDCCSTTAAAKWVAQSGKADDITMGGFDLLT
FT                   QTAEYIERGVLDFSISQNPSEQGYQAVKVLHDYLSGGTEIKGVDTGAQFVTRDNLADTA
FT                   VED"
     atggccccgc gcactctcct cagaagcctc atcgcggcca cagccgcagc agcagccctc        60
     tccctcaccg cctgcggtgc gatcacctcc gccgacggca gctccggcag ctccggcgac       120
     ggatccttca aactcgcccc gtacatccag cagcggatcg acgacgacaa gccgatgcgc       180
     atcaagctca gctaccacga cccgtcgctc gccttcgcca caccgatcag cgcaggcatg       240
     aagaaggccg gcaaggaaac gggtgccgac gtcgctctca tcggccccac cggcggtgac       300
     gccgccaagc aggtctcgga gatccagacg ctcatccagc agaaggccgt cgacggcctc       360
     gccgtctcct ccgcctccag cgacgccctc aagcccgtca tcagccaggc gtacaaggcg       420
     ggcatcccga tcatctcctt caacaccgac aaccccgact ccgaccagat gggattcgtc       480
     ggccaggacc tcaagggctc cggcaaggca caggccgaac aactccgcaa ggacctcaag       540
     ggcgacctca acggcaagtc cgttgtcgtc ttctccgtcg acacgggcgc cggctggtcg       600
     cacgaccgct tcagcggctt caaggaaggc ctggacggca gcggactgaa ggtcgtcggc       660
     cccgtcaacg tcggcaacga gccgagcagc gcctacaaca ccgtcgagtc caccatgtcc       720
     ggtcagtcga acgtggtcgc cgtcgccggc ctcgactgct gctccaccac ggccgccgcc       780
     aagtgggtgg cccagtccgg caaggccgac gacatcacca tgggcggctt cgacctgctc       840
     acccagaccg ccgagtacat cgaacgcggc gtcctggact tcagcatcag ccagaacccg       900
     agcgagcagg gctaccaggc cgtcaaggtg ctgcacgact acctctccgg cggcaccgag       960
     atcaagggcg tggacaccgg cgcccagttc gtcacccgcg acaacctcgc cgacacggcc      1020
     gtggaggact ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page