(data stored in ACNUC7421 zone)

EMBL: AP009493.PE149

AP009493.PE149       Location/Qualifiers
FT   CDS_pept        complement(156816..157853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_149"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_149"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16978"
FT                   /db_xref="GOA:B1VNF5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNF5"
FT                   /protein_id="BAG16978.1"
FT                   /translation="MTSTTTKPPTTAAPPSDASTRQFPLALRRLLHAREAGVFAALVLI
FT                   FLLGTVLSPTFAQSDNLLAVGQQIAQIGIMAVGATFVILNGEIDLSVGSTYALSAISTG
FT                   MLISDGWSWPAAMLVGLAVGAVAGLLNGLAVVVLGVPSFIVTLGTLSVFRGIALLISDG
FT                   APISLSSSQPGVSEFNLLGQGRLFGIVPMQFVFFAAVAAIGVVLLARSRFGFNTYAVGG
FT                   NQEAARLVGVNVKRVKLTAFVLSGFCAGLAGVLGLSFLSYVQGVTGQGLELTVISAVII
FT                   GGAALFGGSGTMWGTVIGVAFIGLLQNILNIKGISSFWQTVVTGLVIVAAVAADTWQRK
FT                   RKTRA"
     gtgacctcga ccaccaccaa gccgcccacc acagcggccc cgccgtccga cgcgagtacc        60
     cggcagttcc cgctcgcgct gcgcagactg ctgcacgcgc gggaggcagg cgtcttcgcc       120
     gcgctcgtcc tgatcttcct cctgggcacc gtgctttcgc cgaccttcgc ccagtccgac       180
     aacctcctcg ccgtgggcca gcagatcgca cagatcggca tcatggccgt cggggcgacc       240
     ttcgtcatcc tcaacgggga gatcgacctc tcggtcggct ccacctacgc cctctccgcg       300
     atctccaccg gcatgctgat atcggacggc tggagctggc ccgcagccat gctcgtcggc       360
     ctcgcggtcg gggccgtcgc cggactcctc aacggcttgg ccgtagtcgt cctcggcgtc       420
     ccgtccttca tcgtcaccct cggcacgctc agcgtcttcc gcggcatcgc cctgctcatc       480
     tccgacggcg ccccgatctc gctgagctcc tcccaacccg gcgtctccga gttcaacctg       540
     ctcggccagg gacggctgtt cggcatcgtg cccatgcagt tcgtcttctt cgccgctgtc       600
     gccgccatcg gcgtcgtact gctggcccgc tcccgcttcg gcttcaacac ctacgcggtc       660
     ggcggcaacc aggaagccgc acggctcgtc ggcgtcaacg tcaagcgagt caagctgacc       720
     gccttcgtcc tctccggttt ctgcgcgggt ctcgccggcg tcctcggcct gtccttcctc       780
     tcctacgtgc agggcgtgac cggacagggc ttggagctca ccgtcatctc ggccgtcatc       840
     atcggcggcg cagccctctt cggcggatcc ggaacgatgt ggggcaccgt catcggcgtc       900
     gccttcatcg gcctcctcca gaacatcctc aacatcaagg gcatctcgtc cttctggcag       960
     accgtcgtca ccggtctcgt catcgtggcc gccgtcgcgg ccgacacctg gcagcgcaag      1020
     cgcaagaccc gggcctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page