(data stored in ACNUC7421 zone)

EMBL: AP009493.PE152

AP009493.PE152       Location/Qualifiers
FT   CDS_pept        complement(159896..162562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_152"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_152"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16981"
FT                   /db_xref="GOA:B1VNF8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNF8"
FT                   /protein_id="BAG16981.1"
FT                   /translation="MRTVPSPGAVEPGGNQGIGQRIELLLAGCERRLVRDGQWLCLFAP
FT                   RPLGSEIPDHGWKLHISARPNDLSPLVDLVVPVLLRYLCDAKFARDAGVLGAMNSGDRD
FT                   PALVGKAITVYPRAEDVRALGGELADLLSGRPGPRVLSDRRIRPDAPVYYRYGPFRATG
FT                   ADDAALTMTGPDGVRFPGRAGTRYRQPPWAADPFRSAAPAPDRPARLIGGRYRLTAGIT
FT                   RSAHGDVYRAVDRATREHLIVKQARAHAGEDAHGVDARGRLRHEHAVLAALTGVDGVPQ
FT                   IREHLRHGDDEFLVTTDCGPRDLRRDVLAHGPFQPGAALSPAGSEPADAMATGRGIAEL
FT                   ARRLLAVLDSVHTRGVVVGDLKPSNVVLGDDGAAHLVDFGISALHGDRPTGATPGYSMP
FT                   AYRAGRPTGPADDLYALGATLYFALTGMDPVVVDSDDDVNRDRTLLCLAAVLPGAEHRP
FT                   VRELVAGLTHPDPAQRAAHGQRWRTQAPALAPERVIPLPRITPGILDDLIAHTVASCVS
FT                   AAAQLPTGAARDGQPGFGLTLYDGAAGVGLELLHHTEQPGVPRAVADLAHRTALHPQLG
FT                   ALSDALHIGRTGVDLFLDSATVLNDAPAPLPPHRGLSHDRTGDQISGAAGVGTGLLALA
FT                   RRARTAGREEEARARLAAAEECAHGLLAARAGRERAEPRSSAADSEAAFTLGFAHGRAG
FT                   VIHFLHAYHRFTGDPAAGAAARQDLAELISHTPRLLALAARPEAHRRYGSWCRGLAGIG
FT                   TLLIETGRYEGDMPATDLGVRCAWSCRDLAPRMSPVSQCCGLSGVGELLIDAAAVTGDD
FT                   RLFRAAEDVAGLILARSGGTMRKPLFPDNTLAASGPGWATGSAGVLSFLRRLRDRGGPR
FT                   LWTDSPARPVARTPRSR"
     gtgcgcacgg tcccgtcacc tggtgcggtc gagcccggcg gcaaccaggg catcggacag        60
     cggatcgagc tgctgctcgc cggctgcgag aggcgactcg tgagggacgg tcagtggctc       120
     tgcctgttcg ccccgcgccc cctcgggagt gagatcccgg accacggttg gaagctgcac       180
     atctccgccc gtccgaacga cctgtcacca ctcgtggatc tggtcgttcc cgtgctgctg       240
     cgctacctct gcgacgccaa gttcgcgcgc gacgccgggg tactgggtgc catgaacagc       300
     ggtgatcgcg atcccgcgct cgtggggaag gcgatcaccg tctatccccg agcggaggat       360
     gtgagagcac tcggcggtga gctcgccgat ctgctgtccg ggagaccggg cccccgagtg       420
     ctcagcgacc ggcggatcag gcccgacgcc cccgtctact accgctacgg cccgttccgg       480
     gccacgggcg ccgacgatgc cgcgctcacc atgaccggtc ccgacggggt gcgtttcccc       540
     ggccgcgcgg gtacccgcta ccgtcagccg ccgtgggccg ccgacccctt ccggtccgcc       600
     gctccagctc ccgaccgtcc cgcgcgtctg atcggcggtc gataccggct caccgcgggc       660
     atcacccgtt ctgcgcacgg cgacgtctac cgcgcggtgg acagggcgac ccgcgagcac       720
     ctgatcgtca aacaggccag ggcccacgcc ggtgaggacg cccacggtgt cgatgcccgc       780
     ggccgcctgc gccacgaaca cgcggtcctg gcggcgctga ccggcgtcga cggcgtcccc       840
     cagatacgcg aacacctccg gcacggtgac gacgaattcc tggtcaccac cgactgcggc       900
     ccccgtgacc tgcgccgcga cgtacttgcc cacggcccct tccagcccgg tgccgcgctc       960
     tcgcccgcgg gctcggaacc ggctgatgcg atggcgaccg gccgcggaat cgccgagctg      1020
     gcacgacgtc tgctcgccgt tctcgacagc gtgcacaccc gaggcgtcgt ggtcggcgat      1080
     ctcaaaccgt ccaatgttgt gctcggcgac gacggtgccg cccacctggt ggatttcggc      1140
     atcagcgcac tgcacggcga ccggcccacc ggtgcgacac cgggctactc gatgccggcg      1200
     taccgagccg gtcggccgac cggaccggcc gacgacctgt acgcgctcgg agcgaccctg      1260
     tacttcgctc tgaccggcat ggatccggtc gtcgtcgaca gcgacgacga cgtcaaccgc      1320
     gaccgcaccc ttctctgtct ggctgccgta ctcccgggcg ccgagcaccg gccggtacgc      1380
     gaactcgtcg ccgggctcac gcaccccgac ccggcacagc gcgcggccca cgggcaacgg      1440
     tggcgcacgc aggcgccggc cttggcgccc gagcgcgtga ttccccttcc gaggatcact      1500
     ccgggcatcc tggacgacct gatcgcacac accgtggcga gctgtgtgag cgccgccgcc      1560
     caactcccga caggggcagc ccgagacggg cagccaggct tcggactgac gctctacgac      1620
     ggcgcggcag gagtgggcct ggagctcctg caccacacgg aacagcccgg cgtgccacgg      1680
     gccgtggccg acctagccca ccggaccgca ctccaccccc agctgggggc cttgtccgac      1740
     gcgctccaca tcggccgtac cggtgtcgac ctcttcctcg actccgccac cgtgctgaac      1800
     gacgcaccgg cgcctctccc gccgcacaga gggctctccc acgaccgcac cggagaccag      1860
     atcagtggcg cggccggcgt cggaaccgga ctgctggcgc tggcccggcg cgcccggacg      1920
     gcggggcgcg aggaagaggc acgcgcgcgc ctggccgcag cggaggagtg cgcccacgga      1980
     ctgctcgccg cgcgggccgg gagggaacga gccgaaccgc gaagctcggc ggcggactcc      2040
     gaagctgcgt tcacgctggg cttcgcccac ggccgcgcgg gcgtcatcca cttcctgcac      2100
     gcctaccacc gcttcaccgg cgatccggcc gccggcgcgg ccgcacgcca ggatctggcc      2160
     gaactgatct cgcacacgcc gaggttgctt gcactcgcgg cccgtcccga agcccaccgg      2220
     cgttacggat cctggtgccg aggactcgcc gggatcggca ccctcctgat cgagacgggc      2280
     aggtacgagg gggacatgcc cgcaacggat ctgggcgtac ggtgcgcctg gtcatgccgc      2340
     gatctcgcac cccggatgag ccccgtctcc cagtgctgcg ggctgtccgg tgtcggcgaa      2400
     ctactcatcg acgcggcggc ggtcaccggc gacgaccggc tgttccgagc ggcggaggac      2460
     gtggcaggac tgatcctggc ccgcagcggc ggcaccatgc ggaagccgct gttccccgac      2520
     aacaccctcg cggcgtcagg gccgggttgg gcgaccggaa gcgcaggcgt tctgtccttc      2580
     ctgcgccgcc tgcgcgatcg gggcggcccg cgcctgtgga ccgacagccc ggcccgaccg      2640
     gtcgcgcgga cgccgcgaag tcggtga                                          2667
//

If you have problems or comments...

PBIL Back to PBIL home page