(data stored in ACNUC7421 zone)

EMBL: AP009493.PE153

AP009493.PE153       Location/Qualifiers
FT   CDS_pept        complement(162618..163127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_153"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16982"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNF9"
FT                   /protein_id="BAG16982.1"
FT                   /translation="MISLIDAGADRSFGWDPARWRFPSRRPPREQATHAVEARTRVRTS
FT                   SVRVCPATTSLRARTFHRNEWQCRRSTIVNIIRTADSDGVAQFYADGSWWGSVLTDGME
FT                   RPPSFFAEKRTVMSSLAVQIRDAGPLDVAVEEEEIPFEDQVDPGRAIEACLPEPFPTAT
FT                   TRVGCD"
     gtgatctcgc tgatcgatgc aggtgctgac cggagcttcg gctgggatcc cgcccggtgg        60
     agattcccga gccgccggcc gccacgggag caggccaccc atgccgtcga ggcgaggacg       120
     agggtgagga cgtcgtccgt aagggtctgt cccgccacaa cttccctgcg ggcaaggaca       180
     tttcatcgta atgaatggca atgtcgtcga tcgacgatcg taaatatcat ccgtacggcg       240
     gactcggatg gggtggccca gttctacgct gatgggtcgt ggtgggggtc ggtactcacc       300
     gacgggatgg agcgcccacc ttccttcttc gcagagaaaa ggaccgtcat gagctctctg       360
     gcagtgcaga tccgtgacgc cggcccactc gatgtggccg tggaggaaga agagattccg       420
     ttcgaggacc aggtcgatcc cggccgcgct atcgaggcgt gtctgcccga accgttcccg       480
     accgcgacga cccgcgttgg ctgcgactag                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page