(data stored in ACNUC7421 zone)

EMBL: AP009493.PE154

AP009493.PE154       Location/Qualifiers
FT   CDS_pept        163444..163818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_154"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16983"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG0"
FT                   /protein_id="BAG16983.1"
FT                   /translation="MSHSTSSEPIERGWDEPWYRVRTEEFQASFLPGDGEDLGEVCNVD
FT                   VSVTLKDGSRWTATVFTVAEVERLMRLWEGTDEALGGRYFWVSDGLIVRDPGIDSMTDV
FT                   IAGLIENDEFTDVFQRVINN"
     atgagccaca gcacatcgtc cgaaccgatc gagcgagggt gggacgagcc ctggtaccgg        60
     gtccgcacgg aggagttcca ggcgtcgttt ctgcccggcg acggcgagga cctgggcgag       120
     gtctgcaacg tcgatgtctc cgtgaccctg aaggatggat ctcgttggac cgcgaccgtg       180
     ttcaccgtcg cggaagtcga gcgcctgatg agactctggg aaggaaccga cgaggccctc       240
     ggcggccggt acttctgggt atcggacggc ctgatcgtca gggatcccgg catcgacagc       300
     atgaccgacg tgatcgccgg actgatcgag aacgacgagt tcaccgacgt ctttcagcgg       360
     gtgatcaata actga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page