(data stored in ACNUC7421 zone)

EMBL: AP009493.PE155

AP009493.PE155       Location/Qualifiers
FT   CDS_pept        164266..164985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_155"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16984"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG1"
FT                   /protein_id="BAG16984.1"
FT                   /translation="MTEGFNVAAELAGVSDRADAWRFIRGFVAHWRKPVRPGDGCDSGE
FT                   LTEAECRLGSQLPAALWEAYGLFGRRPDLTSVQDSLLSPEHLHVDDGALVFRLENQAVA
FT                   EWAIRQEHLTDDDPPVVFRRRDGDSDRWMPFLDRFSTACIEMVLSESLFAHSETRADNR
FT                   PLEESEDIGASPGFQRLALPDYPMWAVEGCVIRWFASPEGLLREDAGEWLWALGLTAPA
FT                   LDSLRGSVPGDWINQPS"
     atgacagagg ggttcaacgt tgctgccgag ctggcgggcg tttcggaccg ggcggatgcc        60
     tggagattca tcaggggatt cgttgcacac tggcgcaagc cggtccggcc cggcgacggt       120
     tgcgattccg gggagctcac cgaggcggag tgccggctgg gatcgcagct gccggcggct       180
     ttgtgggaag cgtacggcct gttcggacgg cgtccggacc tgaccagcgt tcaggactcc       240
     ctgctttccc cggagcacct tcatgtcgac gatggcgcgc tggtgttccg gctggagaac       300
     caagcggtcg ccgagtgggc catccggcag gagcacctga cagacgacga cccgcccgtg       360
     gtcttccggc gcagggacgg cgattcggat cgctggatgc ccttcctcga ccggttttcc       420
     accgcctgta tcgagatggt gctctccgag tccctcttcg ctcacagcga gacgcgggcg       480
     gacaaccggc ctctcgaaga gtcagaggat atcggggcgt cgcccggatt ccagcgtcta       540
     gccttgcccg actacccgat gtgggctgtc gagggatgcg tgatccgatg gttcgcctcg       600
     cccgaagggc tgctgcggga agacgccggc gagtggcttt gggccctggg ccttactgct       660
     ccagcgctgg attcactccg cggttctgtc cccggtgact ggatcaacca accatcgtga       720
//

If you have problems or comments...

PBIL Back to PBIL home page