(data stored in ACNUC7421 zone)

EMBL: AP009493.PE156

AP009493.PE156       Location/Qualifiers
FT   CDS_pept        165050..165343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_156"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16985"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG2"
FT                   /protein_id="BAG16985.1"
FT                   /translation="MNGEASCGARAGGVCPEAEALVKGAFGVARGRRSGAQKMLRFPLK
FT                   WRPGHSWRSEEMRDDGRGDHRCVRCPTRSHLSGLGLTFPLPASLVREWFRHV"
     gtgaacggcg aggcgtcatg cggcgcccgg gccggcggcg tctgccccga ggctgaagcg        60
     ctggtgaagg gagcgttcgg cgttgcccgg ggcagacgca gtggcgcgca gaagatgcta       120
     cggtttccgc tgaagtggcg accaggccac tcttggagat cggaggagat gcgcgatgac       180
     ggtcgtggtg accaccgctg tgtgcggtgc ccgactcgtt cgcatctctc gggtctcggc       240
     ctgacctttc ccctgccggc ctcccttgta cgggagtggt tccggcacgt ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page