(data stored in ACNUC7421 zone)

EMBL: AP009493.PE157

AP009493.PE157       Location/Qualifiers
FT   CDS_pept        165438..166493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_157"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16986"
FT                   /db_xref="GOA:B1VNG3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG3"
FT                   /protein_id="BAG16986.1"
FT                   /translation="MADYGWDAERERSFGPSRDEGLVPGRAVRAERGLCDVVAETGPVR
FT                   AMVLPSSGTGDRLTPCTGDWVSVRPAGPATSATVVEVLERRTAVVRSTSSRTSHAQVLA
FT                   SNVDTVAVAVSLADPLKLGRIERTLALAWESGATPVIVLTKADRSTDPASAASEVAEAA
FT                   PGVEVLVTSATTGEGLDILTAVLSGTVVLLGPSGAGKSTLGNRLLGEDLLATGEVRGSD
FT                   GKGRHTTAWRELVPLPHGGVLLDTPGLRGVGLHDADDGLEHTFAEITELARDCRFADCA
FT                   HTTEPGCAVLAAVEDGRLTQRRLDSYHRLQRENTYAAARTDARLRAELERPMKQISRQV
FT                   RALKQSPHFKA"
     ttggccgact acggctggga cgcggagcgt gagcggtcct tcggtccgtc gagggacgag        60
     gggctggtcc cgggccgtgc agtgcgggcc gagcgcggtc tgtgcgacgt cgtcgccgag       120
     accggccccg tccgcgcgat ggtcctcccc tcctcgggta ccggtgaccg gctgacgccg       180
     tgcaccggcg actgggtgtc cgtccggccg gccggtccgg cgacctccgc caccgtggtg       240
     gaggtgctgg agcgtaggac ggccgtggtc cgctccacct cctcgcgcac ctctcatgcc       300
     caggtgctgg cctccaacgt cgacaccgtg gcggtggccg tctccctcgc cgacccgctc       360
     aagctcgggc ggatcgagcg gacgctcgcc ctggcgtggg agagcggcgc cacacccgtg       420
     atcgtgctca ccaaagccga ccggtccacc gaccccgcct ccgcggcatc cgaggtggcc       480
     gaggcggcac cgggcgtgga ggtgctggtc accagcgcca ccaccggcga gggcctggac       540
     atcctgaccg ccgtcctgtc gggcaccgtg gtcctgctcg gcccctccgg cgccggcaag       600
     tccactctcg gcaaccgcct gctcggcgag gatctcctgg ccactggcga ggtacgcggc       660
     agcgacggca agggcaggca caccaccgca tggcgcgaac tggtgccgct gccccacggc       720
     ggagtcctcc tggacacccc gggtctgcgc ggcgtcgggc tgcacgacgc cgacgacggc       780
     ctggagcaca ccttcgcaga gatcactgag ctggcccgcg attgccgctt cgctgactgc       840
     gcccacacca ccgagcccgg ctgcgccgtg ctggccgccg tcgaggacgg ccgtctcacc       900
     cagcggcgtc tcgacagcta ccaccggctg caacgcgaga acacctacgc agccgcccgc       960
     accgacgcgc ggctgcgtgc cgagctggaa cggccgatga agcagatctc gcgccaggtg      1020
     cgcgccctca agcagtcccc ccacttcaag gcatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page