(data stored in ACNUC7421 zone)

EMBL: AP009493.PE158

AP009493.PE158       Location/Qualifiers
FT   CDS_pept        166490..167257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_158"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16987"
FT                   /db_xref="InterPro:IPR017031"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG4"
FT                   /protein_id="BAG16987.1"
FT                   /translation="MTERNTVMDLPRIFTIRESNHRIHNPLTADKFAALGESLRLPAGT
FT                   RVLDLASGSGEMLCTWARDLGFTGSGVDISTIFTEQAQARAAELGVADRVDFLHGDAAG
FT                   HVTDQPVDLAACVGATWIGDGVAGTTELLQRSLRPGGMMLIGEPFWRQTPPDEETATAC
FT                   HATSIADFLLLPELIGQFRELGYDVVEMMLADQNSWDRYAAAQWLSMRRWLDENPDDEL
FT                   ASEVREELTTEPAHYARYGREYLSWGVFALMKR"
     atgacggaaa ggaacacggt catggacctt ccgcgcatct tcaccatccg tgagagcaac        60
     caccgcatcc acaaccctct gaccgcggac aagttcgccg ccctgggcga atccctccgc       120
     ctccccgccg ggacccgcgt gctcgacctg gccagcggct cgggcgagat gctgtgcacc       180
     tgggcccgcg acctgggttt cacgggctcc ggcgtcgaca tcagcacgat cttcaccgag       240
     caggcccagg cacgcgccgc cgaactcggc gtcgccgacc gggtcgattt cctccacggt       300
     gacgcggccg gccacgtcac cgaccagccg gtcgatctgg ccgcctgcgt gggcgccacc       360
     tggatcggcg acggtgtcgc cggaacaacc gagctgctcc agcgcagcct ccgcccggga       420
     ggaatgatgc tcatcggcga acctttctgg cggcagaccc ctccggacga ggagacggcc       480
     acggcatgcc acgccacctc catcgccgac ttcctgcttc tcccggaact gatcgggcag       540
     ttccgggaac tcgggtacga cgtcgtggaa atgatgctgg ccgaccagaa cagctgggac       600
     cgttacgccg cggcccagtg gctcagcatg cgccgctggc tcgacgagaa cccggacgac       660
     gagctcgcct ccgaagtacg ggaagaactc accaccgagc ccgcccacta cgcccgttac       720
     gggcgtgagt acctcagctg gggggtcttc gctctcatga agcgctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page