(data stored in ACNUC7421 zone)

EMBL: AP009493.PE159

AP009493.PE159       Location/Qualifiers
FT   CDS_pept        167272..167508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_159"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16988"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG5"
FT                   /protein_id="BAG16988.1"
FT                   /translation="MGSGRHILRAPLGTPHPHSDQADGKGERTSSASTQALTFLPGRGS
FT                   SGQGRQSDAAQRRGSICRPECRWPTFANLPIDR"
     gtggggtccg ggcgtcacat cctccgggcc ccactcggga cacctcaccc ccacagcgat        60
     caagccgatg gcaagggcga gaggacatcc tccgcctcca cgcaggccct gaccttcctt       120
     cccggccggg gcagctcggg gcagggccgt cagagcgacg cggcgcagcg tcgcggatcc       180
     atctgccgcc cggagtgccg gtggccgacg tttgcaaacc tacctatcga taggtag          237
//

If you have problems or comments...

PBIL Back to PBIL home page