(data stored in ACNUC7421 zone)

EMBL: AP009493.PE16

AP009493.PE16        Location/Qualifiers
FT   CDS_pept        complement(23792..24679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_16t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_16t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16845"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL4"
FT                   /protein_id="BAG16845.1"
FT                   /translation="MSPATFTAMCSANASSPRRWDGTPARSPRSRSLRVAPDSPTRLVR
FT                   SAQPGHCPDCGNRIDWHPRTDGDDRAVGLHPQELPAAAVPAVSRWHVSSGIAHPAHDGT
FT                   PWCRIPHTALCPARSAPAALTPQLAALRRHLALHTRRLINNDVLTTPAAPPSERTESCR
FT                   PARPVAHLLGVCYIAGHPIDVIQCVAQTRQRHRCTRPVLDDQAPHGTWTLFPTALPSNR
FT                   PLSLPTDRMAVYDLTHLAFAEQLRWRHQHCPGHAASSAADLARTEWEPFDPRLHHQHIH
FT                   QRLPHGARKQNHGA"
     gtgtcacctg ccaccttcac cgccatgtgc tccgccaacg cctcatcccc tcgccggtgg        60
     gacggcaccc ctgcccgctc cccacgctca cggtccctgc gcgtcgcccc cgacagcccc       120
     acccgtctcg tccgcagcgc gcagcccggc cactgccctg actgtggcaa ccgcatcgac       180
     tggcaccccc gcacagacgg cgacgaccga gccgtgggac tccaccccca agaacttccc       240
     gccgctgctg tccctgccgt cagccgctgg cacgtcagct ccggcatcgc ccaccccgcc       300
     cacgacggca ccccgtggtg ccgcatcccg cacaccgccc tgtgccccgc acgcagcgct       360
     cccgcagccc tcacgccaca actggccgcg ctgcgccgcc acctcgccct gcatactcgc       420
     cgcctgatca acaatgacgt cctcaccaca ccggccgccc caccatccga acgaaccgag       480
     tcctgcaggc ccgcccggcc ggtcgctcac cttctaggcg tctgctacat cgccggccac       540
     ccgatcgacg tcatccagtg cgtcgcccag acccggcaac ggcaccgctg tacccgcccc       600
     gtcctcgacg accaagcccc gcacggcacc tggaccctgt tccccaccgc cctccccagc       660
     aaccgacccc tttcgctccc tacggacagg atggccgtct acgacctgac tcacctggcc       720
     tttgccgagc agctgcggtg gcgtcaccag cactgccccg gccacgccgc ctcctcagcc       780
     gctgatctcg cccgcactga gtgggaaccc ttcgacccgc ggctccacca ccagcacatc       840
     caccaacgcc tccctcacgg cgcacgcaag cagaaccacg gggcataa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page