(data stored in ACNUC7421 zone)

EMBL: AP009493.PE160

AP009493.PE160       Location/Qualifiers
FT   CDS_pept        167518..168480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_160"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16989"
FT                   /db_xref="GOA:B1VNG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG6"
FT                   /protein_id="BAG16989.1"
FT                   /translation="MDNAATPSIRTIGLGRDFADHTAVHRLDLEVNAGEVYGLLGPNGS
FT                   GKSTTVRMLTTMLRPSRGTAQVAGADVARDPGTVRRRAGVVLQGTALDPLMSARELLRL
FT                   QGRLQSLTPRQARARCTELLTAFDARDFADTPVGRLSGGQRRRVDLAVALVQRPDVLFL
FT                   DEPTTGLDPASRRDLWDEIRTLAANHGVTVLLTTQHLEEADQLCDRVGILRAGRLIASA
FT                   APHALKDEVGDRFLTLRFRDASAADQARELLAAKGEQLHTAETAPHAVSIRLARPGADG
FT                   ETLLTLASAGLHAESLTVDEPSLEDVFLRLALTPEGAAA"
     atggacaacg ccgccacccc atccatccgt accatcgggc tcggccggga cttcgccgac        60
     cacaccgcgg tccaccggct cgacctggaa gtgaacgccg gagaggtcta cggcctgctc       120
     ggccccaacg gctcgggcaa gagcaccacc gtccggatgc tcaccaccat gctccgcccc       180
     tcccggggca ccgcacaggt cgccggagcc gacgtcgccc gtgaccctgg aacggtccgc       240
     cgccgcgccg gagtcgttct ccagggcacc gccctcgacc ctctgatgtc cgcccgcgaa       300
     ctgctgcgcc tgcaaggacg gctccagtcg ctcacccccc ggcaggcacg ggcacgctgc       360
     accgaactcc tcaccgcctt cgacgcgcgg gacttcgcgg acacccccgt cggcaggctc       420
     agcgggggcc agcgccgccg cgtcgacctc gccgtcgctc tggtccagcg cccggacgtc       480
     ctcttcctcg acgaacccac cacgggactc gacccggcca gccgccggga cctgtgggac       540
     gagatccgca cactggcggc caaccacggc gtcaccgtcc tgctgaccac ccagcacctg       600
     gaggaggccg accagctctg cgaccgcgtc ggcatcctcc gtgccggacg cctcatcgcc       660
     tccgccgccc cgcacgccct caaggacgaa gtcggcgacc gtttcctcac cctgcgattc       720
     cgcgatgcct ccgccgccga ccaggcccgg gaactactcg ccgccaaggg agaacagctc       780
     cacacggccg aaaccgctcc acacgcggtg agtatccggc tcgcccgccc cggggccgat       840
     ggagagacgc tgctcaccct ggcctcagcc ggcctgcacg ccgagtccct gaccgtcgac       900
     gaacccagcc tggaagacgt ctttctccgc ctggccctca ccccggaagg cgccgccgca       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page