(data stored in ACNUC7421 zone)

EMBL: AP009493.PE161

AP009493.PE161       Location/Qualifiers
FT   CDS_pept        168477..169292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_161"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_161"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16990"
FT                   /db_xref="GOA:B1VNG7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG7"
FT                   /protein_id="BAG16990.1"
FT                   /translation="MSTVTTADTAGPPAAPKSWAALGPLTARSLKSCLRTPSLLLSPLL
FT                   TSAFFMIIYEGQLSSVTAAATPGGRYIDVVLPLCLLTTAFTGGATAGQLFVNDIGSGYH
FT                   ARLWLTPVGRWALLAAPVMAGVVVLAAQAAALTGLGLLLGLDPVTGAPAILAIISATVL
FT                   LGTGFLLLAGAVGLHTGNSSAVGSVTLVFFPLSFFTATFVPRDQLGGWMAHAADVNPLT
FT                   PPLEAMRGLLTAPWNEQNLLPGALVALAILVTGAAAAHLALTRRTRTGV"
     atgagcacgg tcaccaccgc cgacactgca ggcccgcccg cagcaccgaa gtcgtgggca        60
     gccctcgggc ctctgaccgc ccgctcgctc aagtcctgcc tccgtacgcc gtccctgctg       120
     ctctccccgc tgctcaccag cgcgttcttc atgatcatct acgaggggca gctgtcgtcg       180
     gtcacggccg cagccactcc cggcggtcgc tacatcgacg tggttctgcc actgtgcctg       240
     ctcaccaccg ccttcaccgg cggcgccacc gcgggtcagc tgttcgtgaa cgacatcggc       300
     tcgggctatc acgcccggct ctggctcacc ccggtcggcc gctgggccct tctcgccgca       360
     cccgtcatgg caggcgtcgt cgtcctcgcc gctcaggccg cagcgctcac cggactcggc       420
     ctgctgctcg gcctggaccc cgtcaccggg gcccccgcta tcctggcgat catcagtgcc       480
     accgtcctgc tgggtacggg cttcctgttg ctggccggcg cggtgggcct ccacaccggg       540
     aacagctcgg cagtcggctc cgtgaccctc gtcttcttcc cgctctcctt cttcaccgcc       600
     acgttcgtcc cgcgtgacca gctcggcggc tggatggccc acgctgccga cgtcaacccg       660
     ctcaccccgc cgctggaggc catgcgcggc ctgctcaccg caccctggaa cgagcagaac       720
     ctgctgccgg gcgctctcgt cgctctcgcc atcctggtga cgggcgccgc agcggcccac       780
     ctcgccctga cccgccgtac ccgtacagga gtctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page