(data stored in ACNUC7421 zone)

EMBL: AP009493.PE169

AP009493.PE169       Location/Qualifiers
FT   CDS_pept        complement(175312..175578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_169"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16998"
FT                   /db_xref="GOA:B1VNH5"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH5"
FT                   /protein_id="BAG16998.1"
FT                   /translation="MKASKVAYKPMGFVLGALSGMIASAVFKQTWKVVEGEGDAPDALD
FT                   EDRPWRQILLAAAIQGAIFAVVKATVERSGAQATRRVTGTWPA"
     gtgaaagcgt ccaaggtcgc ctacaaaccg atggggttcg tcctcggcgc actcagcggc        60
     atgatcgcga gcgccgtgtt caaacagacc tggaaggtcg tcgaaggcga gggcgatgct       120
     cccgacgctc tcgacgagga ccgtccgtgg cggcagatcc tgctcgccgc cgccatccag       180
     ggggcgatct tcgccgtggt caaggctacc gtcgagcgct cgggagcgca ggcgacccgg       240
     cgcgtcacgg gcacctggcc ggcgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page