(data stored in ACNUC7421 zone)

EMBL: AP009493.PE170

AP009493.PE170       Location/Qualifiers
FT   CDS_pept        complement(175575..176030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16999"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH6"
FT                   /protein_id="BAG16999.1"
FT                   /translation="MNDESRNKMGTPTPEEVREQVERTRDELGQTVEALAGKADVKAQA
FT                   AEKTAAVKEQAAAATAQIREKTMHAAETVKNRTPDVVQEKTAQAATQVRESAAQAGQFV
FT                   MDRTPEPLLEKADRAGRAARANRTPLLAGGALLIAFLLIRRGRGRNK"
     atgaacgacg agtcgcggaa caagatgggt acgcccactc ccgaggaagt gcgcgagcag        60
     gtcgagcgga cgcgcgacga actcggtcag accgtcgaag cactggcggg caaggccgac       120
     gtcaaggcac aggccgcgga gaagaccgcg gcggtgaagg agcaggccgc agcggccact       180
     gcccagatcc gggagaagac catgcatgcc gcggagaccg tcaagaacag gacgccggac       240
     gtcgtgcagg agaagacggc acaggcagct acgcaggtgc gagagagcgc ggcccaggcc       300
     ggacagttcg tgatggaccg tacccccgaa ccacttctgg agaaggcgga ccgggccggg       360
     agggccgccc gggccaaccg caccccgctt ctcgcgggcg gtgcgctgct gatcgccttc       420
     ctgctgatac gccgcggtcg ggggcgcaac aagtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page