(data stored in ACNUC7421 zone)

EMBL: AP009493.PE171

AP009493.PE171       Location/Qualifiers
FT   CDS_pept        complement(176027..176443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_171"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_171"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17000"
FT                   /db_xref="GOA:B1VNH7"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNH7"
FT                   /protein_id="BAG17000.1"
FT                   /translation="MSTAGRQTPSTSEEPVGVLVSRASQQISELVREEMLLARSEMTEK
FT                   GKRFGKGGGLFGAAGIVGILAAQALVATCIAALALALPLWAAALIVTVVLAAVAGMAAL
FT                   AGKKQVARAGTPAPEQTINSVKADVAEVKERVHR"
     atgagtacag caggacggca aactcccagt accagcgagg agccggtggg ggttctcgtc        60
     tcgcgtgcct cgcagcagat ctcggaactg gtccgcgagg aaatgctgct ggcacgttcg       120
     gagatgacgg agaagggcaa gcgattcggt aagggcggtg gcctgttcgg tgctgcgggg       180
     atcgtcggca tcctcgcggc tcaggccctt gtggcgacct gcatagccgc gctcgcactg       240
     gccctgcccc tgtgggcggc agctctcatc gtcacggttg tgctggccgc agtggccggt       300
     atggccgccc ttgcagggaa gaaacaggtc gcccgggccg gaacccccgc gccggagcag       360
     accatcaaca gcgtcaaggc cgatgtggcc gaggtcaagg agagggtcca ccgatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page