(data stored in ACNUC7421 zone)

EMBL: AP009493.PE175

AP009493.PE175       Location/Qualifiers
FT   CDS_pept        complement(179058..179201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_175"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17004"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI1"
FT                   /protein_id="BAG17004.1"
FT                   /translation="MLPPDCSQPKTPTTVTLPGRSGSATDPRSPHSQMVPEATSLMLPT
FT                   PS"
     atgctgcccc cggactgttc gcagccgaag acccccacga ccgtcaccct gcccgggcga        60
     tccggatctg cgacggaccc gaggagcccg cattcccaga tggtgccgga ggcgacatcc       120
     ttgatgcttc caacaccctc atag                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page