(data stored in ACNUC7421 zone)

EMBL: AP009493.PE176

AP009493.PE176       Location/Qualifiers
FT   CDS_pept        complement(179227..179610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_176"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17005"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI2"
FT                   /protein_id="BAG17005.1"
FT                   /translation="MAERARAELADAVQACRVCRAQAVRYRTLIDRARFWAFATLVAGP
FT                   VGRWFTEPRGTASASGRSLLAAGQGAASAQFGGRAVAHDSAPWYRWRPLPPAPGPGVAS
FT                   TQPIRCVTAPVRNPGCVTDSAEW"
     atggcggagc gtgccagggc cgagttggcc gacgctgttc aggcctgtcg ggtgtgccgc        60
     gcgcaagccg tgcggtacag gaccctgatc gaccgggccc ggttctgggc ctttgcgacg       120
     ctggtggcgg ggccggtcgg gaggtggttc accgagcccc gcggtactgc ttcggccagc       180
     gggcgcagtt tgctggccgc cgggcaggga gcggccagcg ctcagttcgg tggtcgtgcc       240
     gtcgctcacg actcggcccc ctggtatcgg tggcggccct tgccaccggc accaggcccc       300
     ggagtggcga gcacacagcc catccggtgt gtgactgctc ccgtgcgaaa tccagggtgc       360
     gtgacggact ctgccgagtg gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page