(data stored in ACNUC7421 zone)

EMBL: AP009493.PE179

AP009493.PE179       Location/Qualifiers
FT   CDS_pept        complement(181916..182449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_179"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17008"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI5"
FT                   /protein_id="BAG17008.1"
FT                   /translation="MKILEAVSYDVLMSRFTREHPYDPCDEANSNDEAAAHIRDAHRVL
FT                   CGRWHRVLLEGPEVLDVVLPWHLGEGGDVELIPPTGLTVAAAAIRLTALDATYTRTNPL
FT                   CALKLTRQTHAPARPLYLSTRAMPTRDYAALTVREGLVHLDGLHRMLAWHRSGMLAPGR
FT                   WVEAYLAGLPDAPG"
     gtgaagattc tggaagccgt cagctacgac gtgctcatga gccgcttcac cagggaacat        60
     ccctacgacc cctgcgacga ggccaactcg aacgacgagg ccgccgcgca catccgtgac       120
     gcgcatcgcg tcctctgcgg gcgctggcac cgggttctac tggagggacc cgaggtactc       180
     gatgtcgtgc tgccgtggca cctgggcgaa ggcggcgacg tcgaactgat cccgccgacc       240
     ggcctcacgg tggccgccgc ggcgatccgt ctcaccgcgc tcgacgccac gtacacgcgg       300
     accaatccgc tctgcgcgct caagctgacg cgccagaccc acgccccggc ccggccgttg       360
     tatctgagca cccgggcaat gccgacccgg gactacgcgg cgctgaccgt ccgggaaggt       420
     ctggtccatc tcgacggcct gcaccggatg ctggcttggc accgcagcgg catgctggcc       480
     ccgggccgct gggtcgaggc ctacctcgcg ggactgcccg acgcaccggg ctag             534
//

If you have problems or comments...

PBIL Back to PBIL home page