(data stored in ACNUC7421 zone)

EMBL: AP009493.PE18

AP009493.PE18        Location/Qualifiers
FT   CDS_pept        25180..26358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_18t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_18t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16847"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL6"
FT                   /protein_id="BAG16847.1"
FT                   /translation="MLPPTPPPHSTGRSISPRTRRKTNQMRLCTTPLVRRIWTVELRPD
FT                   HGGSMLHCLQCSPSAPSVRTAPSQALTHLAGHARHDFLPRHLRTCQCHSHGCRWHPRHR
FT                   GCSGPVLLVLTRERGGRLWRLADTCAACAAATAHAAVVPDTVLATASPAESVKRIRQRR
FT                   RGRTPHGPSEQVRVREMLSYLAAALPARTSATARLLALQCALRSTVAGDVTIPAGLIRG
FT                   MRLPSEPSAFTELEAAGWLRSPTRPTQRAGFSVELLDTAVRMQAPTRADRARAANWILR
FT                   TCQMSEIRQLGTSPRLLALALAAHLPDEPGAPASAEQEVLARMCGLPPQELIPLLDTLA
FT                   ATHFLRSWAHGAVPEDLHWELDRHNHLTGNRSSLESDRVTSHTGQAEDPGAE"
     gtgctgccgc ccactccccc gccccacagc accggcagat caatctcgcc caggaccagg        60
     agaaagacca atcagatgag gctctgcacg acgccgctgg tgcgacgcat ctggaccgtg       120
     gagctgcgcc ctgaccacgg agggagcatg ctgcactgcc tgcagtgctc gccctccgct       180
     ccgtccgtgc ggaccgcgcc gtcccaggca ctaacccacc tggccggcca cgcccgccac       240
     gacttcctgc cccggcacct tcggacctgc cagtgccact cacacggctg ccgttggcac       300
     ccacgccacc gcggctgctc cggacccgtc ctgctcgtcc tcacccgcga acgcggcggc       360
     cggctctggc ggctcgccga cacctgcgcc gcctgcgcgg cagcgactgc ccacgccgcg       420
     gtcgtacccg acacagtcct cgctacggct tctccggcag agtcggtgaa acgaatccgg       480
     caaaggcggc gcgggaggac gccgcacgga ccctcggagc aggtgcgcgt gcgggagatg       540
     ctcagctatc tggccgctgc tcttcccgcc cggaccagtg caactgctcg cctgctggcc       600
     ctccagtgcg ccctgcgttc caccgtcgcc ggggacgtga ccatccctgc cggcttgatc       660
     cgcggtatgc ggcttccctc ggagccgtct gcgttcaccg aactggaagc cgccggctgg       720
     ctgcgctccc ccacccgacc gacgcagcgc gcaggcttct ccgtggaact cttggacacc       780
     gctgtgcgga tgcaagcgcc gactcgcgca gaccgcgccc gcgcggccaa ctggattctg       840
     cgcacctgcc agatgagcga aatccgccaa ctcggcacat ccccccgtct gctggcactg       900
     gcactggccg cgcacctccc ggacgagccc ggcgcgccag catctgctga acaggaagtc       960
     ctcgcgcgca tgtgcggcct cccgcctcaa gagctcatcc ccttgctcga cacacttgcc      1020
     gccacgcact tcctgcgctc ctgggcacac ggcgctgtcc ccgaagacct gcactgggag      1080
     ctcgaccggc acaaccacct caccggaaac cgctcaagcc ttgagtctga ccgtgtgacc      1140
     tcacataccg gccaggctga agaccctggc gcagagtaa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page