(data stored in ACNUC7421 zone)

EMBL: AP009493.PE181

AP009493.PE181       Location/Qualifiers
FT   CDS_pept        complement(183606..184649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_181"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17010"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI7"
FT                   /protein_id="BAG17010.1"
FT                   /translation="MRRRTANDAEQRWGQEVAVDPVEEFAAWLRHLHREAKKPSYTEIV
FT                   RRIRMTDPTASVVVSTISETLNGKRLPRWTTVEPIARVLGGPTAAEECLRRWKQADAAR
FT                   TPTATQSDTAPIPDSIAPGLETEGAAAGSVASHSSFAPGRSGEAADPDQGAREGEAPVH
FT                   APRGRQSPVRMVSAASALAVAVAAWAAVTVIDDRNQAPAGGPTAVTPTALDPRPTGGTS
FT                   GAVADAPEAAAQPQFKPGTYETELTVNEGSWASPDGNIRIRVPGASTSDGPTIFVTTPS
FT                   VSCPQTTVAIGDALIVPEVSGSSWTRITTVKVWAEDTPNGEAFDMYVQLQVDQGTGRAP
FT                   QGQGCAS"
     gtgcgccgaa ggacggcgaa cgacgccgaa cagcgatggg ggcaggaggt ggcggtggac        60
     ccggtcgaag agtttgccgc ttggctgcgt cacctgcacc gggaagcgaa gaagcccagc       120
     tacaccgaga tcgtccgccg gatccggatg accgacccga ctgcgagtgt ggtcgtcagc       180
     acgatctccg agaccctcaa cggcaaacgc ctcccgcgct ggacgacggt ggaaccgatc       240
     gcccgggtcc tgggcgggcc caccgcggca gaggaatgtt tgcgccgctg gaagcaggcc       300
     gacgctgccc gcaccccaac cgccacgcag agcgacacgg caccgatccc tgacagtatc       360
     gcccccggcc tggaaactga gggtgctgcc gccgggtcag tggcgagcca ctcctccttc       420
     gctccgggca gaagcggaga ggcagccgat ccggatcagg gggcgcgcga aggggaggcg       480
     ccggttcacg ctccacgtgg gagacagtct ccggtgcgga tggtgagtgc ggccagtgcc       540
     ctggccgtgg ctgtggcggc ctgggcagcc gtaaccgtca tcgacgaccg gaaccaggca       600
     cccgccggag gcccgacagc cgtcacgccc accgcactgg acccccgtcc caccggcgga       660
     acatcgggag cggtagcgga cgccccggaa gccgccgcgc agcctcagtt caagcccggc       720
     acctacgaaa cagagctgac cgtcaacgag ggatcctggg cgtcgccaga cggcaacatc       780
     cgtatccgcg tgcccggcgc atccaccagc gatggcccaa cgatcttcgt caccacaccc       840
     tcggtctcct gcccgcagac cacggtggcg atcggcgacg cactcatcgt gccggaagta       900
     tcgggaagct catggacccg catcaccacc gtgaaggtat gggcagagga caccccgaac       960
     ggcgaagcct tcgacatgta cgtccagctc caggtcgacc aaggcacggg ccgcgcgccg      1020
     caagggcaag gatgcgcttc ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page