(data stored in ACNUC7421 zone)

EMBL: AP009493.PE182

AP009493.PE182       Location/Qualifiers
FT   CDS_pept        complement(184687..184881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_182"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17011"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNI8"
FT                   /protein_id="BAG17011.1"
FT                   /translation="MPASPELGAGQQETEDFTGVGAPGGVVGQDRDGGGQEWTKYAKHD
FT                   AGERHNEQHHEGGFPVGTG"
     gtgcctgctt cgcctgagct tggggcgggt caacaggaga cagaggactt cacgggcgtc        60
     ggcgcgccgg gcggggtcgt gggccaggac cgcgacggcg gtggccagga gtggaccaag       120
     tacgccaagc acgacgccgg cgagcggcac aatgagcaac atcatgaggg cggctttccg       180
     gtaggaacgg gataa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page